| Sequence 1: | NP_476899.1 | Gene: | robo1 / 37603 | FlyBaseID: | FBgn0005631 | Length: | 1395 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001157990.1 | Gene: | Iglon5 / 210094 | MGIID: | 2686277 | Length: | 336 | Species: | Mus musculus |
| Alignment Length: | 329 | Identity: | 85/329 - (25%) |
|---|---|---|---|
| Similarity: | 134/329 - (40%) | Gaps: | 72/329 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 269 GQTATFHCSVGGDPPPKVLWKKEEGNIPVSRARILH-------------------DEKSLEISNI 314
Fly 315 TPTDEGTYVCEAHNNVGQISARASLIVHAPPNFTKRPSNKKVGLNGVVQLPCMASGNPPPSVFW- 378
Fly 379 -TKEGVSTLMFPNSSHGRQHVAADGTLQITDVRQEDEGYYVCSAFSVVDSS--TVRVFLQVSSLD 440
Fly 441 ERPPPIIQIGPANQTLPKGSVATLPCRATGNPSPRIKWFHDGHAVQAGNRYSI-IQ----GSSLR 500
Fly 501 VDDLQLSDSGTYTCTASGERGETSWAATLTVEKPGSTSLHRAADPSTYPAPPGTPKVLNVSRTSI 565
Fly 566 SLRW 569 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| robo1 | NP_476899.1 | Ig | 56..151 | CDD:299845 | |
| I-set | 56..150 | CDD:254352 | |||
| I-set | 157..251 | CDD:254352 | |||
| Ig2_Robo | 159..251 | CDD:143201 | |||
| I-set | 255..341 | CDD:254352 | 18/90 (20%) | ||
| Ig3_Robo | 272..341 | CDD:143202 | 17/87 (20%) | ||
| IG_like | 351..436 | CDD:214653 | 25/88 (28%) | ||
| Ig | 362..444 | CDD:299845 | 23/85 (27%) | ||
| I-set | 445..531 | CDD:254352 | 23/90 (26%) | ||
| IGc2 | 459..521 | CDD:197706 | 17/66 (26%) | ||
| FN3 | 549..637 | CDD:238020 | 7/21 (33%) | ||
| FN3 | 673..762 | CDD:238020 | |||
| fn3 | 770..855 | CDD:278470 | |||
| Iglon5 | NP_001157990.1 | Ig | 41..129 | CDD:416386 | 18/90 (20%) |
| Ig strand A' | 41..46 | CDD:409353 | |||
| Ig strand B | 48..56 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 56..60 | CDD:409353 | 0/4 (0%) | ||
| FR2 | 61..68 | CDD:409353 | 2/14 (14%) | ||
| Ig strand C | 61..67 | CDD:409353 | 2/13 (15%) | ||
| CDR2 | 69..79 | CDD:409353 | 2/9 (22%) | ||
| Ig strand C' | 71..74 | CDD:409353 | 2/2 (100%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 80..115 | CDD:409353 | 8/34 (24%) | ||
| Ig strand D | 84..91 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 94..100 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 107..115 | CDD:409353 | 4/7 (57%) | ||
| CDR3 | 116..120 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 120..129 | CDD:409353 | 1/8 (13%) | ||
| FR4 | 122..129 | CDD:409353 | 1/6 (17%) | ||
| Ig strand A | 132..137 | CDD:409353 | 1/4 (25%) | ||
| Ig_3 | 134..199 | CDD:404760 | 21/78 (27%) | ||
| Ig strand A' | 140..145 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 148..157 | CDD:409353 | 4/8 (50%) | ||
| Ig strand C | 163..167 | CDD:409353 | 1/3 (33%) | ||
| Ig strand D | 174..177 | CDD:409353 | 1/2 (50%) | ||
| Ig strand E | 178..183 | CDD:409353 | 1/11 (9%) | ||
| Ig strand F | 191..199 | CDD:409353 | 3/7 (43%) | ||
| Ig_3 | 217..295 | CDD:404760 | 22/79 (28%) | ||
| putative Ig strand A | 218..224 | CDD:409353 | 2/5 (40%) | ||
| Ig strand B | 234..238 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 274..278 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 288..293 | CDD:409353 | 3/4 (75%) | ||
| Ig strand G | 301..304 | CDD:409353 | 2/4 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||