DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo1 and Nectin2

DIOPT Version :9

Sequence 1:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster
Sequence 2:NP_033016.3 Gene:Nectin2 / 19294 MGIID:97822 Length:530 Species:Mus musculus


Alignment Length:472 Identity:102/472 - (21%)
Similarity:160/472 - (33%) Gaps:154/472 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 LNGVVQLPCMASGNPPPSVFWTKEGVSTLM-------------------FPNSSHGRQHVA---- 399
            |.|.|:|||...   ||    |.|.||.:.                   ||||...:..::    
Mouse    46 LGGTVELPCHLL---PP----TTERVSQVTWQRLDGTVVAAFHPSFGVDFPNSQFSKDRLSFVRA 103

  Fly   400 --------ADGTLQITDVRQEDEGYYVCSAFSVVDSSTVR--VFLQVSSLDERPPPI--IQIGPA 452
                    .|.||....:|.||||.|.|. |:...:.|.|  .:|:|.:..|.....  :.|||.
Mouse   104 RPETNADLRDATLAFRGLRVEDEGNYTCE-FATFPNGTRRGVTWLRVI
AQPENHAEAQEVTIGPQ 167

  Fly   453 NQTLPKGSVATLPCRAT-GNPSPRIKWFHD--GHA-------VQAG-----NRYSIIQGSSLRVD 502
                   |||...|.:| |.|..||.|...  |.|       :|||     :|||::...  |.|
Mouse   168 -------SVAVARCVSTGGRPPARITWISSLGGEAKDTQEPGIQAGTVTIISRYSLVPVG--RAD 223

  Fly   503 DLQLSDSGTYTCTASGERGETS--WAATLTVEKPGSTSLHRAADPSTYPAPPGTPKVLNVSRTSI 565
            .:::      ||....|..|..  ...||:|..|...|: ...|.:.|           :.|:..
Mouse   224 GVKV------TCRVEHESFEEPILLPVTLSV
RYPPEVSI-SGYDDNWY-----------LGRSEA 270

  Fly   566 SLRW-AKSQEKPGAVGPIIGYTVEYFSPDLQT--GWIVAAQRVGDTQVTISGLTPGTSYVFLVRA 627
            .|.. .:|..:|          .:|   |..|  |...|:.....:|:.:..:....:..|:..|
Mouse   271 ILTCDVRSNPEP----------TDY---DWSTTSGVFPASAVAQGSQLLVHSVDRMVNTTFICTA 322

  Fly   628 ENTQGISVPSGLSNTIKTIEADFDAASANDLSAARTLLTGKSVELIDASAINASAV------RLE 686
            .|..|    :|.:..:..:......|.|    .|...:.|..:..|.|:|:..:.:      |.|
Mouse   323 TNAVG----TGRAEQVILVRESPSTAGA----GATGGIIGGIIAAIIATAVAGTGILICRQQRKE 379

  Fly   687 WMLHVSADEKYVEG--------------------------------LRIHYKDASVPSA-----Q 714
            ..|..:.:|:.:||                                ::..|.||.|..|     :
Mouse   380 QRLQAADEEEELEGPPSYKPPTPKAKLEEPEMPSQLFTLGASEHSPVKTPYFDAGVSCADQEMPR 444

  Fly   715 YHSITVMDASAESFVVG 731
            ||.:..::..:...::|
Mouse   445 YHELPTLEERSGPLLLG 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352
Ig2_Robo 159..251 CDD:143201
I-set 255..341 CDD:254352
Ig3_Robo 272..341 CDD:143202
IG_like 351..436 CDD:214653 30/110 (27%)
Ig 362..444 CDD:299845 30/114 (26%)
I-set 445..531 CDD:254352 29/104 (28%)
IGc2 459..521 CDD:197706 23/76 (30%)
FN3 549..637 CDD:238020 14/90 (16%)
FN3 673..762 CDD:238020 17/102 (17%)
fn3 770..855 CDD:278470
Nectin2NP_033016.3 IG_like 40..149 CDD:214653 30/110 (27%)
Ig1_PVR_like 48..150 CDD:143195 29/109 (27%)
Ig 153..248 CDD:299845 30/109 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..407 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.