| Sequence 1: | NP_476899.1 | Gene: | robo1 / 37603 | FlyBaseID: | FBgn0005631 | Length: | 1395 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_005805.1 | Gene: | GPA33 / 10223 | HGNCID: | 4445 | Length: | 319 | Species: | Homo sapiens |
| Alignment Length: | 249 | Identity: | 58/249 - (23%) |
|---|---|---|---|
| Similarity: | 92/249 - (36%) | Gaps: | 66/249 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 323 VCEAHNNVGQISARASLIVHAPPNFTKRPSNKKVGLNGVVQLPC---MASGNPPPSVFWTK---- 380
Fly 381 --EGVSTLMFPNSS--HG---RQHVA-------ADGTLQITDVRQEDEGYYVCSAFSVVD----- 426
Fly 427 SSTVRVFLQVSSLDERPPPIIQIGPANQTLPKGSVATLPCRA-TGNPSPRIKWFHDGHAVQAGNR 490
Fly 491 YSII----------QGSSLRVDDLQLSDSGTYTCTASGERGETSWAATLTVEKP 534 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| robo1 | NP_476899.1 | Ig | 56..151 | CDD:299845 | |
| I-set | 56..150 | CDD:254352 | |||
| I-set | 157..251 | CDD:254352 | |||
| Ig2_Robo | 159..251 | CDD:143201 | |||
| I-set | 255..341 | CDD:254352 | 4/17 (24%) | ||
| Ig3_Robo | 272..341 | CDD:143202 | 4/17 (24%) | ||
| IG_like | 351..436 | CDD:214653 | 25/110 (23%) | ||
| Ig | 362..444 | CDD:299845 | 25/107 (23%) | ||
| I-set | 445..531 | CDD:254352 | 22/96 (23%) | ||
| IGc2 | 459..521 | CDD:197706 | 18/72 (25%) | ||
| FN3 | 549..637 | CDD:238020 | |||
| FN3 | 673..762 | CDD:238020 | |||
| fn3 | 770..855 | CDD:278470 | |||
| GPA33 | NP_005805.1 | V-set | 26..138 | CDD:311561 | 26/117 (22%) |
| IGc2 | 154..218 | CDD:197706 | 18/73 (25%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 267..319 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||