DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and GRR1

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_012623.1 Gene:GRR1 / 853552 SGDID:S000003850 Length:1151 Species:Saccharomyces cerevisiae


Alignment Length:409 Identity:98/409 - (23%)
Similarity:179/409 - (43%) Gaps:70/409 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 NLFP-ELLEQIFEHLPVR-DLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRG 213
            |:.| |:|..|.:.|..: |:.:...|...|     |:.:.|.:..:.|:.              
Yeast   318 NMLPSEILHLILDKLNQKYDIVKFLTVSKLW-----AEIIVKILYYRPHIN-------------- 363

  Fly   214 IKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLC-KQITDT 277
             ||.|:        ||.|....|||...  .||...|            :|.|:.|.. ..:.||
Yeast   364 -KKSQL--------DLFLRTMKLTSEET--VFNYRLM------------IKRLNFSFVGDYMHDT 405

  Fly   278 SLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLA------- 335
            .|.... ..:|||.|.|..|.:||:..:..:..|.|.|:.:::.....:||.....||       
Yeast   406 ELNYFV-GCKNLERLTLVFCKHITSVPISAVLRGCKFLQSVDITGIRDVSDDVFDTLATYCPRVQ 469

  Fly   336 GF----SRETAEGNLQ--------LEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDS 388
            ||    :|.....:|:        |:.:.:.....::||.:..:|.....|..::::...:||||
Yeast   470 GFYVPQARNVTFDSLRNFIVHSPMLKRIKITANNNMNDELVELLANKCPLLVEVDITLSPNVTDS 534

  Fly   389 G-LKHLARMPKLEQLNLRSCDNISD---IGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLY 449
            . ||.|.|:.:|.:..:....||:|   ..::.:.:....:..:|:|.|:.|:|:.:..|.....
Yeast   535 SLLKLLTRLVQLREFRITHNTNITDNLFQELSKVVDDMPSLRLIDLSGCENITDKTIESIVNLAP 599

  Fly   450 RLRSLSLNQC-QITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQL 513
            :||::.|.:| :|||..:.:::|....|:.::.|.|..|||.|::.|....|.::.:|...||.|
Yeast   600 KLRNVFLGKCSRITDASLFQLSKLGKNLQTVHFGHCFNITDNGVRALFHSCTRIQYVDFACCTNL 664

  Fly   514 SSKGIDIIMKLPKLQKLNL 532
            :::.:..:..||||:::.|
Yeast   665 TNRTLYELADLPKLKRIGL 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 10/40 (25%)
AMN1 <226..>334 CDD:187754 28/108 (26%)
leucine-rich repeat 236..256 CDD:275381 6/19 (32%)
leucine-rich repeat 263..288 CDD:275381 6/25 (24%)
leucine-rich repeat 289..314 CDD:275381 8/24 (33%)
leucine-rich repeat 315..347 CDD:275381 8/42 (19%)
AMN1 347..524 CDD:187754 44/189 (23%)
leucine-rich repeat 348..373 CDD:275381 4/24 (17%)
leucine-rich repeat 374..398 CDD:275381 9/24 (38%)
leucine-rich repeat 399..424 CDD:275381 4/27 (15%)
leucine-rich repeat 425..450 CDD:275381 6/24 (25%)
leucine-rich repeat 451..475 CDD:275381 8/24 (33%)
leucine-rich repeat 476..501 CDD:275381 8/24 (33%)
GRR1NP_012623.1 F-box-like 320..361 CDD:403981 10/45 (22%)
AMN1 404..559 CDD:187754 38/155 (25%)
leucine-rich repeat 416..441 CDD:275381 8/24 (33%)
leucine-rich repeat 442..467 CDD:275381 5/24 (21%)
leucine-rich repeat 494..519 CDD:275381 4/24 (17%)
leucine-rich repeat 520..545 CDD:275381 9/24 (38%)
leucine-rich repeat 546..574 CDD:275381 4/27 (15%)
AMN1 <574..737 CDD:187754 32/110 (29%)
leucine-rich repeat 575..600 CDD:275381 6/24 (25%)
leucine-rich repeat 601..626 CDD:275381 8/24 (33%)
leucine-rich repeat 627..652 CDD:275381 8/24 (33%)
leucine-rich repeat 653..677 CDD:275381 5/23 (22%)
leucine-rich repeat 678..704 CDD:275381 2/6 (33%)
leucine-rich repeat 707..732 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46756
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.