DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and RAD7

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_012586.1 Gene:RAD7 / 853512 SGDID:S000003813 Length:565 Species:Saccharomyces cerevisiae


Alignment Length:380 Identity:102/380 - (26%)
Similarity:167/380 - (43%) Gaps:70/380 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 SSPSLFNCL--VKRGIKKVQI------LSLRRSLKDLVLGV---PALTSLNLSGCFNVADMNLGH 254
            ||..:||.|  |..|:....:      ||..|:|.|..|.:   ..|..|..|.|..:: .:...
Yeast   190 SSKLVFNKLRDVLGGVSTANLNNLAKALSKNRALNDHTLQLFLKTDLKRLTFSDCSKIS-FDGYK 253

  Fly   255 AFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNI---TNTGLLLIAWGLKKLK 316
            ..::..|:|..|.|.:|.|:...||..||:.|.||::|.|.|...|   |.....:|..|  :|:
Yeast   254 TLAIFSPHLTELSLQMCGQLNHESLLYIAEKLPNLKSLNLDGPFLINEDTWEKFFVIMKG--RLE 316

  Fly   317 HLNLRSCWHISDQGIGHL----------AGFSRETAEGNLQL--EYLGLQD-----C-------Q 357
            ..::.:....:|:.:.:|          .|.||..:..|..|  :|| :.|     |       :
Yeast   317 EFHISNTHRFTDKSLSNLLINCGSTLVSLGLSRLDSISNYALLPQYL-VNDEFHSLCIEYPFNEE 380

  Fly   358 RLSDE----ALGHIAQGLTSLKSINLSFCVSVTDS----GLKHLARMPK---LEQLNLRSCDNIS 411
            .::||    .||.|.:   :|:.:.|:.|:.:|||    ||  .|.:|:   ||.|:|...|.|:
Yeast   381 DVNDEIIINLLGQIGR---TLRKLVLNGCIDLTDSMIINGL--TAFIPEKCPLEVLSLEESDQIT 440

  Fly   412 DIGMAYLTEGGSGINSLDVSF--CDKISDQALTHIAQGLYR--LRSLSLNQC-QITDHGMLKIAK 471
            ...::|........|.::.||  |.::.|.|:..:.....|  ||||:||.. ::|....  :|.
Yeast   441 TDSLSYFFSKVELNNLIECSFRRCLQLGDMAIIELLLNGARDSLRSLNLNSLKELTKEAF--VAL 503

  Fly   472 ALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSK-----GIDII 521
            |...|..|::|....:.|..:|.|.|...||..||::|...::.|     |:.:|
Yeast   504 ACPNLTYLDLGFVRCVDDSVIQMLGEQNPNLTVIDVFGDNLVTEKATMRPGLTLI 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689
AMN1 <226..>334 CDD:187754 29/113 (26%)
leucine-rich repeat 236..256 CDD:275381 4/19 (21%)
leucine-rich repeat 263..288 CDD:275381 10/24 (42%)
leucine-rich repeat 289..314 CDD:275381 8/27 (30%)
leucine-rich repeat 315..347 CDD:275381 7/41 (17%)
AMN1 347..524 CDD:187754 58/210 (28%)
leucine-rich repeat 348..373 CDD:275381 10/42 (24%)
leucine-rich repeat 374..398 CDD:275381 9/27 (33%)
leucine-rich repeat 399..424 CDD:275381 7/24 (29%)
leucine-rich repeat 425..450 CDD:275381 6/26 (23%)
leucine-rich repeat 451..475 CDD:275381 9/24 (38%)
leucine-rich repeat 476..501 CDD:275381 7/24 (29%)
RAD7NP_012586.1 AMN1 228..440 CDD:187754 57/220 (26%)
leucine-rich repeat 236..261 CDD:275381 4/25 (16%)
leucine-rich repeat 262..287 CDD:275381 10/24 (42%)
leucine-rich repeat 288..340 CDD:275381 11/53 (21%)
leucine-rich repeat 342..365 CDD:275381 7/23 (30%)
leucine-rich repeat 368..397 CDD:275381 6/31 (19%)
leucine-rich repeat 398..426 CDD:275381 10/29 (34%)
leucine-rich repeat 428..455 CDD:275381 7/26 (27%)
leucine-rich repeat 456..475 CDD:275381 5/18 (28%)
leucine-rich repeat 484..507 CDD:275381 9/24 (38%)
leucine-rich repeat 508..533 CDD:275381 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I1756
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.