DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and KDM2B

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_011537169.1 Gene:KDM2B / 84678 HGNCID:13610 Length:1353 Species:Homo sapiens


Alignment Length:365 Identity:93/365 - (25%)
Similarity:144/365 - (39%) Gaps:82/365 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LRFTPYALHH------RPPHHQLQTLPPALYLQHAAAAAAAAAAAAAHAQHHHHHHHHLPHRPAS 137
            |..||..|.|      |.|...:...||::           :.......:.|       ..|| .
Human  1004 LNGTPRELRHQLGPSLRSPPRVISRPPPSV-----------SPPKCIQMERH-------VIRP-P 1049

  Fly   138 PESPPPVE------GTHISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKL 196
            |.||||..      ..|:  :..|:...:|.:|..:||....:||..|......|.:|..::.. 
Human  1050 PISPPPDSLPLDDGAAHV--MHREVWMAVFSYLSHQDLCVCMRVCRTWNRWCCDKRLWTRIDLN- 1111

  Fly   197 HLKRSSPSLFNCLVKRGIKKVQILSL--------RRSLKDLVLGVPALTSLNLSGCFNVADMNLG 253
            |.|..:|.:.:.:::|     |.:||        ::.|..|:..:|.|..|.||||..:|   :.
Human  1112 HCKSITPLMLSGIIRR-----QPVSLDLSWTNISKKQLSWLINRLPGLRDLVLSGCSWIA---VS 1168

  Fly   254 HAFSVDLPNLKTLDL------------SLCKQITDTSLGRI--AQHLRNLETLELGGCCNITNTG 304
            ...|...|.|:|||:            .|....||...|::  ...|||:..|.|.| .:||:..
Human  1169 ALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGQMDNRSKLRNIVELRLAG-LDITDAS 1232

  Fly   305 LLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEAL----- 364
            |.||...:..|..|:|..|.|::||.|..|......|.:   .|..:.|.||.:::|:.|     
Human  1233 LRLIIRHMPLLSKLHLSYCNHVTDQSINLLTAVGTTTRD---SLTEINLSDCNKVTDQCLSFFKR 1294

  Fly   365 -GHIAQGLTSLKSINLSFCVSVTDSGLKH-LARMPKLEQL 402
             |:|..       |:|.:|..||..|.:. :|.|...|.:
Human  1295 CGNICH-------IDLRYCKQVTKEGCEQFIAEMSDEESI 1327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 9/40 (23%)
AMN1 <226..>334 CDD:187754 39/121 (32%)
leucine-rich repeat 236..256 CDD:275381 7/19 (37%)
leucine-rich repeat 263..288 CDD:275381 9/38 (24%)
leucine-rich repeat 289..314 CDD:275381 8/24 (33%)
leucine-rich repeat 315..347 CDD:275381 10/31 (32%)
AMN1 347..524 CDD:187754 17/63 (27%)
leucine-rich repeat 348..373 CDD:275381 8/30 (27%)
leucine-rich repeat 374..398 CDD:275381 8/24 (33%)
leucine-rich repeat 399..424 CDD:275381 1/4 (25%)
leucine-rich repeat 425..450 CDD:275381
leucine-rich repeat 451..475 CDD:275381
leucine-rich repeat 476..501 CDD:275381
KDM2BXP_011537169.1 JmjC 182..257 CDD:214721
cupin_like 229..335 CDD:304367
zf-CXXC <615..651 CDD:251032
PHD_KDM2B 661..722 CDD:277114
F-box-like 1071..1111 CDD:289689 10/39 (26%)
leucine-rich repeat 1105..1129 CDD:275381 5/29 (17%)
AMN1 1121..1310 CDD:187754 56/207 (27%)
leucine-rich repeat 1130..1153 CDD:275381 4/22 (18%)
leucine-rich repeat 1154..1177 CDD:275381 8/25 (32%)
leucine-rich repeat 1178..1217 CDD:275381 9/38 (24%)
leucine-rich repeat 1218..1242 CDD:275381 8/24 (33%)
leucine-rich repeat 1243..1272 CDD:275381 10/31 (32%)
leucine-rich repeat 1273..1297 CDD:275381 6/23 (26%)
leucine-rich repeat 1298..1323 CDD:275381 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.