DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and AT1G80570

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_974191.1 Gene:AT1G80570 / 844396 AraportID:AT1G80570 Length:480 Species:Arabidopsis thaliana


Alignment Length:432 Identity:104/432 - (24%)
Similarity:173/432 - (40%) Gaps:96/432 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 EAKLHLKRSSPSLFNCLVKRGIKKVQIL------SLRRSLKD-----LVLGVPALTSLNLSGCFN 246
            :|.|.|.|..|:|         .||:|:      .|.:.:.|     |.....:||.|.||.|..
plant    67 DALLSLCRRFPNL---------SKVEIIYSGWMSKLGKQVDDQGLLVLTTNCHSLTDLTLSFCTF 122

  Fly   247 VADMNLGHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWG 311
            :.|:.:||..|  .|.|.:|.|:...:||...:..:|...:.|..|.|..|.|:.:...|.....
plant   123 ITDVGIGHLSS--CPELSSLKLNFAPRITGCGVLSLAVGCKKLRRLHLIRCLNVASVEWLEYFGK 185

  Fly   312 LKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLE------YLGLQD-------------CQ 357
            |:.|:.|.:::|..|.:..:..|....|:..  :||.|      |:.:.|             |.
plant   186 LETLEELCIKNCRAIGEGDLIKLRNSWRKLT--SLQFEVDANYRYMKVYDQLDVERWPKQLVPCD 248

  Fly   358 RLSDEALGH--IAQG---------LTSLKSINLSFCVSVTDSGL-------KHLA---------- 394
            .|.:.:||:  ||.|         ..:|:.::|..|..|:||.:       .||.          
plant   249 SLVELSLGNCIIAPGRGLACVLRNCKNLEKLHLDMCTGVSDSDIIALVQKASHLRSISLRVPSDF 313

  Fly   395 RMPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRL------RS 453
            .:|.|..:.||    ::|..::.:.:..|.:.|..:||.|.......:...||:..|      |.
plant   314 TLPLLNNITLR----LTDESLSAIAQHCSKLESFKISFSDGEFPSLFSFTLQGIITLIQKCPVRE 374

  Fly   454 LSLNQ-CQITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSKG 517
            |||:. |...|.||..:..| .:||.|.:..|..::|:|| .|.....:|..:.|..|..::..|
plant   375 LSLDHVCVFNDMGMEALCSA-QKLEILELVHCQEVSDEGL-ILVSQFPSLNVLKLSKCLGVTDDG 437

  Fly   518 IDIIMKLPKLQKLNLGLWLVRXC-------VHHDCNACAAKE 552
            :..::...||:     |.:|..|       ||....:.:.|:
plant   438 MRPLVGSHKLE-----LLVVEDCPQVSRRGVHGAATSVSFKQ 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689
AMN1 <226..>334 CDD:187754 30/112 (27%)
leucine-rich repeat 236..256 CDD:275381 9/19 (47%)
leucine-rich repeat 263..288 CDD:275381 6/24 (25%)
leucine-rich repeat 289..314 CDD:275381 7/24 (29%)
leucine-rich repeat 315..347 CDD:275381 6/31 (19%)
AMN1 347..524 CDD:187754 53/230 (23%)
leucine-rich repeat 348..373 CDD:275381 10/54 (19%)
leucine-rich repeat 374..398 CDD:275381 8/40 (20%)
leucine-rich repeat 399..424 CDD:275381 4/24 (17%)
leucine-rich repeat 425..450 CDD:275381 6/24 (25%)
leucine-rich repeat 451..475 CDD:275381 10/30 (33%)
leucine-rich repeat 476..501 CDD:275381 8/24 (33%)
AT1G80570NP_974191.1 AMN1 77..309 CDD:187754 58/244 (24%)
leucine-rich repeat 79..111 CDD:275381 7/40 (18%)
leucine-rich repeat 112..136 CDD:275381 10/25 (40%)
leucine-rich repeat 137..162 CDD:275381 6/24 (25%)
leucine-rich repeat 163..188 CDD:275381 7/24 (29%)
leucine-rich repeat 189..226 CDD:275381 9/38 (24%)
AMN1 241..435 CDD:187754 48/199 (24%)
leucine-rich repeat 250..275 CDD:275381 6/24 (25%)
leucine-rich repeat 276..301 CDD:275381 6/24 (25%)
leucine-rich repeat 302..339 CDD:275381 6/40 (15%)
leucine-rich repeat 340..368 CDD:275381 7/27 (26%)
leucine-rich repeat 372..396 CDD:275381 9/24 (38%)
leucine-rich repeat 397..421 CDD:275381 8/24 (33%)
leucine-rich repeat 422..446 CDD:275381 4/23 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.