DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and AT1G50980

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_175511.1 Gene:AT1G50980 / 841520 AraportID:AT1G50980 Length:370 Species:Arabidopsis thaliana


Alignment Length:238 Identity:49/238 - (20%)
Similarity:90/238 - (37%) Gaps:76/238 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 FPE-LLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEA-------KLHLK-------RSS 202
            ||: :|.:|...||.:|:.....:...||      |:||.|:.       .|.||       :..
plant    37 FPDKVLLKILSLLPSKDVVATGVLSKRWR------SLWKDVKTFRTSSVESLQLKINPSATNKDI 95

  Fly   203 PSLFNCLVKRGIKKVQI------LSLRRS------LKDLVLG------------VPALTSLNLSG 243
            .||.|..|.|.:::::|      ..|.:|      |:.::|.            :|.|..|:|..
plant    96 QSLVNMAVARSMRELRIEMICKNFELPKSFYMFSQLETVILDKVSLMDPPPDVHLPCLKRLHLLS 160

  Fly   244 CFNVADMNLGHAFSVDLPNLKTLDL--------------------SLCKQITDTSLGRIAQHLRN 288
            ..::.::.:   |::|:|.|:.|.:                    ||...:...:..:....|.:
plant   161 VNSLTNVMI---FTIDVPTLRILSIDNTSGKSRPKGVHGFVINTPSLSVNVVFDNPYKFLAPLGS 222

  Fly   289 LETLELGGCCNIT-NTGLLLIAWGLKKLKHLNLRSC----WHI 326
            .:.|.|   |::| :|......:....|.||.|..|    |::
plant   223 TQYLSL---CSVTSHTTYRPAVFSFIFLDHLELCLCSAEQWNL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 10/37 (27%)
AMN1 <226..>334 CDD:187754 25/138 (18%)
leucine-rich repeat 236..256 CDD:275381 3/19 (16%)
leucine-rich repeat 263..288 CDD:275381 5/44 (11%)
leucine-rich repeat 289..314 CDD:275381 5/25 (20%)
leucine-rich repeat 315..347 CDD:275381 6/16 (38%)
AMN1 347..524 CDD:187754
leucine-rich repeat 348..373 CDD:275381
leucine-rich repeat 374..398 CDD:275381
leucine-rich repeat 399..424 CDD:275381
leucine-rich repeat 425..450 CDD:275381
leucine-rich repeat 451..475 CDD:275381
leucine-rich repeat 476..501 CDD:275381
AT1G50980NP_175511.1 F-box 33..78 CDD:279040 13/46 (28%)
leucine-rich repeat 131..152 CDD:275379 2/20 (10%)
leucine-rich repeat 177..203 CDD:275379 2/25 (8%)
leucine-rich repeat 249..271 CDD:275379 5/14 (36%)
FBD 296..341 CDD:285573
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.