DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and VFB1

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_175151.1 Gene:VFB1 / 841121 AraportID:AT1G47056 Length:518 Species:Arabidopsis thaliana


Alignment Length:443 Identity:106/443 - (23%)
Similarity:176/443 - (39%) Gaps:93/443 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 PVEG--------THISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLK 199
            |:|.        .:.|:|..|.|..:|:.|...:..|.|.||..|............:.|:..|.
plant    26 PIESIESEISQPDYTSSLPDECLALVFQFLNSGNRKRCALVCRRWMIVEGQNRYRLSLHARSDLI 90

  Fly   200 RSSPSLFNCLVKRGIKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLK 264
            .|.||||:     ....|..|||:...:.:.:|..||..::|. |                .|||
plant    91 TSIPSLFS-----RFDSVTKLSLKCDRRSVSIGDEALVKISLR-C----------------RNLK 133

  Fly   265 TLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQ 329
            .|.|..|:::||..:...|::.::|:....|.|           .:|.|.:|.: |..|.::.:.
plant   134 RLKLRACRELTDVGMAAFAENCKDLKIFSCGSC-----------DFGAKGVKAV-LDHCSNLEEL 186

  Fly   330 GIGHLAGFSRETAE------GNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFC------ 382
            .|..|.||:....|      ....|:.:.|::.  .:.:..|.:..|..:|||:.|..|      
plant   187 SIKRLRGFTDIAPEMIGPGVAASSLKSICLKEL--YNGQCFGPVIVGAKNLKSLKLFRCSGDWDL 249

  Fly   383 ----VSVTDSGLK--HLARMPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQAL 441
                :|..|.|:.  ||.||            .:||:.::.::. .|.:.||.:....:.::..|
plant   250 LLQEMSGKDHGVVEIHLERM------------QVSDVALSAISY-CSSLESLHLVKTPECTNFGL 301

  Fly   442 THIAQGLYRLRSLSLNQCQ---ITDHGMLKIAKALHELENL-NIGQCSRITDKGLQTLAEDLTNL 502
            ..||:...|||.|.::..:   |.|.|::.:||...:|:.| .||  ...|...|..||....||
plant   302 AAIAEKCKRLRKLHIDGWKANLIGDEGLVAVAKFCSQLQELVLIG--VNPTTLSLGMLAAKCLNL 364

  Fly   503 KTIDLYGCTQLSSKGID-IIMKLPKLQKLNLGLWLVRXC------VHHDCNAC 548
            :.:.|.||.......:. |..|.|.|:||     .::.|      :.:..|.|
plant   365 ERLALCGCDTFGDPELSCIAAKCPALRKL-----CIKNCPISDVGIENLANGC 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 11/40 (28%)
AMN1 <226..>334 CDD:187754 23/107 (21%)
leucine-rich repeat 236..256 CDD:275381 3/19 (16%)
leucine-rich repeat 263..288 CDD:275381 8/24 (33%)
leucine-rich repeat 289..314 CDD:275381 4/24 (17%)
leucine-rich repeat 315..347 CDD:275381 8/37 (22%)
AMN1 347..524 CDD:187754 47/193 (24%)
leucine-rich repeat 348..373 CDD:275381 4/24 (17%)
leucine-rich repeat 374..398 CDD:275381 12/35 (34%)
leucine-rich repeat 399..424 CDD:275381 2/24 (8%)
leucine-rich repeat 425..450 CDD:275381 5/24 (21%)
leucine-rich repeat 451..475 CDD:275381 8/26 (31%)
leucine-rich repeat 476..501 CDD:275381 8/25 (32%)
VFB1NP_175151.1 F-box-like 41..>70 CDD:403981 10/28 (36%)
AMN1 87..>202 CDD:187754 37/148 (25%)
leucine-rich repeat 103..125 CDD:275381 7/21 (33%)
leucine-rich repeat 132..157 CDD:275381 8/24 (33%)
leucine-rich repeat 158..182 CDD:275381 8/35 (23%)
leucine-rich repeat 183..224 CDD:275381 7/42 (17%)
leucine-rich repeat 235..260 CDD:275381 7/24 (29%)
leucine-rich repeat 261..284 CDD:275381 6/35 (17%)
AMN1 271..>412 CDD:187754 38/148 (26%)
leucine-rich repeat 285..310 CDD:275381 5/24 (21%)
leucine-rich repeat 311..338 CDD:275381 8/26 (31%)
leucine-rich repeat 339..363 CDD:275381 8/25 (32%)
leucine-rich repeat 364..389 CDD:275381 6/24 (25%)
leucine-rich repeat 390..414 CDD:275381 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.