DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and AT1G15740

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_563980.2 Gene:AT1G15740 / 838143 AraportID:AT1G15740 Length:585 Species:Arabidopsis thaliana


Alignment Length:341 Identity:117/341 - (34%)
Similarity:184/341 - (53%) Gaps:44/341 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 NCLVKRGIKKVQILSLRRSLK-----------DLVLGVPALTSLNLSGCFNVADMNLGHAFSVD- 259
            ||:....::.:.:|:..|||:           ..:.|:..|..|||.||.:|.      |..:| 
plant   247 NCITDADMEPLSVLTNLRSLQICCSKITDIGISYLKGLNKLNLLNLEGCRHVT------AACLDT 305

  Fly   260 ---LPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLR 321
               |..|..|:|:.| ..:|:...:.:. |.||:.|.| |..||||:.|:.:. ||.||:.|||.
plant   306 LTALAGLMYLNLNRC-NFSDSGCEKFSD-LINLKILNL-GMNNITNSCLVHLK-GLTKLESLNLD 366

  Fly   322 SCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVT 386
            || .|.|:|:.||:|.        |:|:.|.|.|.: :....|.|:: ||::|:||||||.| ||
plant   367 SC-RIGDEGLVHLSGM--------LELKSLELSDTE-VGSNGLRHLS-GLSNLESINLSFTV-VT 419

  Fly   387 DSGLKHLARMPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRL 451
            ||||:.|:.:..|..||| ...:::|.|::.|| ..:|:..||: |..:|:|....|: :.|.:|
plant   420 DSGLRKLSGLTSLRTLNL-DARHVTDAGLSALT-SLTGLTHLDL-FGARITDSGTNHL-RNLKKL 480

  Fly   452 RSLSLNQCQITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSK 516
            :||.:....:||.|:..| |.|..|..||:.|.|.:|||.|: |...||.|.::::.. :::||.
plant   481 QSLEICGGGLTDTGVKNI-KDLSSLTLLNLSQNSNLTDKTLE-LISGLTGLVSLNVSN-SRVSSS 542

  Fly   517 GIDIIMKLPKLQKLNL 532
            |:..:..|..|:.|.|
plant   543 GLRHLKPLKNLRSLTL 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689
AMN1 <226..>334 CDD:187754 40/122 (33%)
leucine-rich repeat 236..256 CDD:275381 7/19 (37%)
leucine-rich repeat 263..288 CDD:275381 6/24 (25%)
leucine-rich repeat 289..314 CDD:275381 11/24 (46%)
leucine-rich repeat 315..347 CDD:275381 12/31 (39%)
AMN1 347..524 CDD:187754 64/176 (36%)
leucine-rich repeat 348..373 CDD:275381 8/24 (33%)
leucine-rich repeat 374..398 CDD:275381 15/23 (65%)
leucine-rich repeat 399..424 CDD:275381 8/24 (33%)
leucine-rich repeat 425..450 CDD:275381 7/24 (29%)
leucine-rich repeat 451..475 CDD:275381 9/23 (39%)
leucine-rich repeat 476..501 CDD:275381 11/24 (46%)
AT1G15740NP_563980.2 leucine-rich repeat 62..98 CDD:275381
AMN1 86..275 CDD:187754 6/27 (22%)
leucine-rich repeat 114..139 CDD:275381
leucine-rich repeat 164..188 CDD:275381
leucine-rich repeat 189..213 CDD:275381
leucine-rich repeat 214..237 CDD:275381
leucine-rich repeat 238..262 CDD:275381 3/14 (21%)
leucine-rich repeat 263..297 CDD:275381 10/33 (30%)
LRR_RI <298..470 CDD:238064 73/196 (37%)
leucine-rich repeat 298..335 CDD:275381 10/44 (23%)
LRR_8 311..370 CDD:290566 25/63 (40%)
leucine-rich repeat 336..359 CDD:275381 11/24 (46%)
leucine-rich repeat 384..402 CDD:275380 5/18 (28%)
leucine-rich repeat 408..431 CDD:275381 15/23 (65%)
leucine-rich repeat 432..455 CDD:275381 8/24 (33%)
leucine-rich repeat 456..479 CDD:275381 7/24 (29%)
leucine-rich repeat 480..523 CDD:275381 18/44 (41%)
leucine-rich repeat 529..552 CDD:275380 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101394
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.