DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and AFB3

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_563915.1 Gene:AFB3 / 837838 AraportID:AT1G12820 Length:577 Species:Arabidopsis thaliana


Alignment Length:427 Identity:96/427 - (22%)
Similarity:167/427 - (39%) Gaps:91/427 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 NLFP-ELLEQIFEHLPV-RDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRG 213
            |.|| |::|.:|:.:.. :|....:.||.:|..          :|   ...|....:.||..   
plant     2 NYFPDEVIEHVFDFVASHKDRNSISLVCKSWHK----------IE---RFSRKEVFIGNCYA--- 50

  Fly   214 IKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNL-GHAFSVDL-PNLKTL--------DL 268
                  ::..|    |:...|.|.||.|.|..:.||.|| .|.:...: |.::.|        :|
plant    51 ------INPER----LIRRFPCLKSLTLKGKPHFADFNLVPHEWGGFVHPWIEALARSRVGLEEL 105

  Fly   269 SLCKQ-ITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIG 332
            .|.:. :||.||..:::...|.::|.|..|...|..||..||...:.|:.|:|:.  :..|...|
plant   106 RLKRMVVTDESLDLLSRSFANFKSLVLVSCEGFTTDGLASIAANCRHLRELDLQE--NEIDDHRG 168

  Fly   333 HLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHLARM- 396
            .......::....:.|.:..|:....::  ||..:.....:|||:.|:..|.     |..|||: 
plant   169 QWLNCFPDSCTTLMSLNFACLKGETNVA--ALERLVARSPNLKSLKLNRAVP-----LDALARLM 226

  Fly   397 ---PKLEQLNLRSCDNISD-----------------------IGMAYLTEGG-----SGINSLDV 430
               |:|..|.:.|.:|..|                       :.:|.|....     ..:.||::
plant   227 SCAPQLVDLGVGSYENEPDPESFAKLMTAIKKYTSLRSLSGFLEVAPLCLPAFYPICQNLISLNL 291

  Fly   431 SFCDKISDQALTHIAQGLYRLRSLSLNQCQITDHGMLKIAKALHELENLNI---------GQCSR 486
            |:..:|....|..:.|...||:.|.:.. .|.|.|:..:|....||:.|.:         ...:.
plant   292 SYAAEIQGNHLIKLIQLCKRLQRLWILD-SIGDKGLAVVAATCKELQELRVFPSDVHGEEDNNAS 355

  Fly   487 ITDKGLQTLAEDLTNLKTIDLYGCTQLSSKGIDIIMK 523
            :|:.||..::.....|.:| ||.|.|:::..:..:.|
plant   356 VTEVGLVAISAGCPKLHSI-LYFCKQMTNAALIAVAK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 10/40 (25%)
AMN1 <226..>334 CDD:187754 34/118 (29%)
leucine-rich repeat 236..256 CDD:275381 10/20 (50%)
leucine-rich repeat 263..288 CDD:275381 7/33 (21%)
leucine-rich repeat 289..314 CDD:275381 8/24 (33%)
leucine-rich repeat 315..347 CDD:275381 5/31 (16%)
AMN1 347..524 CDD:187754 47/218 (22%)
leucine-rich repeat 348..373 CDD:275381 4/24 (17%)
leucine-rich repeat 374..398 CDD:275381 9/27 (33%)
leucine-rich repeat 399..424 CDD:275381 7/52 (13%)
leucine-rich repeat 425..450 CDD:275381 6/24 (25%)
leucine-rich repeat 451..475 CDD:275381 6/23 (26%)
leucine-rich repeat 476..501 CDD:275381 5/33 (15%)
AFB3NP_563915.1 F-box_5 1..42 CDD:408301 12/52 (23%)
leucine-rich repeat 35..62 CDD:275381 6/42 (14%)
Transp_inhibit 61..107 CDD:408562 14/45 (31%)
leucine-rich repeat 102..126 CDD:275381 6/23 (26%)
leucine-rich repeat 127..152 CDD:275381 8/24 (33%)
leucine-rich repeat 153..207 CDD:275381 9/57 (16%)
leucine-rich repeat 208..255 CDD:275381 15/51 (29%)
AMN1 262..>393 CDD:187754 28/132 (21%)
leucine-rich repeat 286..311 CDD:275381 6/24 (25%)
leucine-rich repeat 312..335 CDD:275381 6/23 (26%)
leucine-rich repeat 336..370 CDD:275381 5/33 (15%)
leucine-rich repeat 371..395 CDD:275381 7/22 (32%)
leucine-rich repeat 396..430 CDD:275381
leucine-rich repeat 431..454 CDD:275381
leucine-rich repeat 455..479 CDD:275381
leucine-rich repeat 505..529 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.