DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and AT5G52480

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_200061.3 Gene:AT5G52480 / 835324 AraportID:AT5G52480 Length:241 Species:Arabidopsis thaliana


Alignment Length:161 Identity:39/161 - (24%)
Similarity:76/161 - (47%) Gaps:37/161 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 SDEALGHIAQGLTSLKSINLSFCVSVTDSG-LKHLARMPKLEQLNLRSCDNISDIGMAYLTEGGS 423
            ||..|.:||:..::|:|:.| .|..:||.| ::.:.::|.||:|.:                  |
plant    40 SDSLLTYIAERSSNLRSLRL-MCSEITDDGFVQAVVKLPMLEELEV------------------S 85

  Fly   424 GINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQ-----CQITDHGMLKIAKALHELENLNIGQ 483
            ||:         :|.:::.........|::|.||:     ....||..:.||:::.:|.:|.:  
plant    86 GIS---------LSGESMKLAGLSCPNLKTLMLNRLFYLSSDDDDHDAIAIAESMPKLRHLQL-- 139

  Fly   484 C-SRITDKGLQTLAEDLTNLKTIDLYGCTQL 513
            | :::|..||..:.:...:|:.:||..|..|
plant   140 CGNKLTKTGLNAILDGCPHLEHLDLRQCINL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689
AMN1 <226..>334 CDD:187754
leucine-rich repeat 236..256 CDD:275381
leucine-rich repeat 263..288 CDD:275381
leucine-rich repeat 289..314 CDD:275381
leucine-rich repeat 315..347 CDD:275381
AMN1 347..524 CDD:187754 39/161 (24%)
leucine-rich repeat 348..373 CDD:275381 5/12 (42%)
leucine-rich repeat 374..398 CDD:275381 7/24 (29%)
leucine-rich repeat 399..424 CDD:275381 3/24 (13%)
leucine-rich repeat 425..450 CDD:275381 2/24 (8%)
leucine-rich repeat 451..475 CDD:275381 8/28 (29%)
leucine-rich repeat 476..501 CDD:275381 6/25 (24%)
AT5G52480NP_200061.3 AMN1 <40..167 CDD:187754 37/156 (24%)
leucine-rich repeat 54..78 CDD:275381 7/24 (29%)
leucine-rich repeat 79..103 CDD:275381 7/50 (14%)
leucine-rich repeat 134..158 CDD:275381 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.