DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and AT5G23340

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_197725.1 Gene:AT5G23340 / 832398 AraportID:AT5G23340 Length:405 Species:Arabidopsis thaliana


Alignment Length:374 Identity:101/374 - (27%)
Similarity:178/374 - (47%) Gaps:40/374 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 VCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRGIKKVQILSLRRSLKDLVLGVPALTSL 239
            ||..|.:............|..|:.|...|.|..:|:..:.:    |:.||.      .|.:|..
plant    34 VCKRWLNLQSTDRKK
LAARAGPHMLRRLASRFTQIVELDLSQ----SISRSF------YPGVTDS 88

  Fly   240 NLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTG 304
            :|      |.::.|..|      |:.|:|..||.||||.|..|.:.|..|:.|::..|..:::.|
plant    89 DL------AVISEGFKF------LRVLNLHNCKGITDTGLASIGRCLSLLQFLDVSYCRKLSDKG 141

  Fly   305 LLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQ 369
            |..:|.|...|:.|:|..|..|:|:.:..|:...|:       ||.||||.|..::|..|..:.:
plant   142 LSAVAEGCHDLRALHLAGCRFITDESLKSLSERCRD-------LEALGLQGCTNITDSGLADLVK 199

  Fly   370 GLTSLKSINLSFCVSVTDSGLKHLAR--MPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSF 432
            |...:||::::.|.:|.|:|:..:|:  ...|:.|.|..|..:.:..::.|.:....:.:|.:..
plant   200 GCRKIKSLDINKCSNVGDAGVSSVAKACASSLKTLKLLDCYKVGNESISSLAQFCKNLETLIIGG 264

  Fly   433 CDKISDQALTHIAQGLY-RLRSLSLNQC-QITDHGMLKIAKALHELENLNIGQCSRITDKGLQTL 495
            |..|||:::..:|.... .|::|.::.| .|:|..:..|.|....||.|:||.|..:||...:.|
plant   265 CRDISDESIMLLADSCKDSLKNLRMDWCLNISDSSLSCILKQCKNLEALDIGCCEEVTDTAFRDL 329

  Fly   496 -AEDLTNLKTIDLYGCTQLSSKGI-DIIMKLPKLQKLNLGLWLVRXCVH 542
             ::|:..||.:.:..||:::..|| .::.|...|:.::     ||...|
plant   330 GSDDVLGLKVLKVSNCTKITVTGIGKLLDKCSSLEYID-----VRSLPH 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 3/14 (21%)
AMN1 <226..>334 CDD:187754 31/107 (29%)
leucine-rich repeat 236..256 CDD:275381 4/19 (21%)
leucine-rich repeat 263..288 CDD:275381 12/24 (50%)
leucine-rich repeat 289..314 CDD:275381 7/24 (29%)
leucine-rich repeat 315..347 CDD:275381 8/31 (26%)
AMN1 347..524 CDD:187754 51/182 (28%)
leucine-rich repeat 348..373 CDD:275381 10/24 (42%)
leucine-rich repeat 374..398 CDD:275381 7/25 (28%)
leucine-rich repeat 399..424 CDD:275381 5/24 (21%)
leucine-rich repeat 425..450 CDD:275381 6/25 (24%)
leucine-rich repeat 451..475 CDD:275381 7/24 (29%)
leucine-rich repeat 476..501 CDD:275381 10/25 (40%)
AT5G23340NP_197725.1 F-box_5 12..48 CDD:408301 3/13 (23%)
leucine-rich repeat 68..99 CDD:275381 9/46 (20%)
AMN1 85..323 CDD:187754 73/256 (29%)
leucine-rich repeat 100..125 CDD:275381 12/24 (50%)
leucine-rich repeat 126..151 CDD:275381 7/24 (29%)
leucine-rich repeat 152..177 CDD:275381 7/24 (29%)
leucine-rich repeat 178..203 CDD:275381 10/24 (42%)
leucine-rich repeat 204..230 CDD:275381 7/25 (28%)
leucine-rich repeat 231..256 CDD:275381 5/24 (21%)
leucine-rich repeat 257..283 CDD:275381 6/25 (24%)
leucine-rich repeat 284..309 CDD:275381 7/24 (29%)
leucine-rich repeat 310..336 CDD:275381 10/25 (40%)
leucine-rich repeat 337..362 CDD:275381 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I1964
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.