DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and AT5G21900

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_680178.1 Gene:AT5G21900 / 832250 AraportID:AT5G21900 Length:544 Species:Arabidopsis thaliana


Alignment Length:420 Identity:102/420 - (24%)
Similarity:183/420 - (43%) Gaps:76/420 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 SVWKGVEAKLHLKRSSPSLFNCLVK------RGIKKVQIL--SLRRSLKDLVLGV---------- 233
            |....:|..|:::|.:|||.....:      ..||.::::  .||:.|..||.|:          
plant   128 STTSDMEIDLNVRRKAPSLVELSARVLAQNFLAIKSLKLVPDHLRKKLSYLVSGLGEFDTRLMEL 192

  Fly   234 ---PALTSLNLSGCFNVADMNLGHAF-SVDLPNLKTLDLSLC-KQITDTSLGRIAQHLRN----L 289
               .:.:.:....|..:.:.:|...| ..|..:||.|.|.|| :.:||.::.:..:...|    |
plant   193 LIEDSPSEICAKNCVQLVEDDLVKIFCDCDRVSLKVLILDLCGRSMTDYTINQFFKRAPNGFPSL 257

  Fly   290 ETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQ 354
            .||.|.|...:|:..||||:.....|:::||..|..::.:.:..||.....|..|      |.:.
plant   258 TTLSLQGAFCLTDNALLLISKSSPLLQYINLTECSLLTYRALRILADKFGSTLRG------LSIG 316

  Fly   355 DCQRLSD-----------EALGHIA-QGLTS----------------LKSINLSFCVSVTDSGLK 391
            .||.:..           |.|.::: .||.|                |..::|:.|..|||..:.
plant   317 GCQGIKKHKGFSSSLYKFEKLNYLSVAGLVSVNDGVVRSFFMFRSSILTDLSLANCNEVTDECMW 381

  Fly   392 HLAR-MPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQ---ALTHIAQGLYRLR 452
            |:.| ..|||.|::...|.::|..:.::|||...:.||.:: .::.||:   |...::.|  .||
plant   382 HIGRYCKKLEALDITDLDKLTDKSLEFITEGCRYLKSLKLT-SNRFSDECIAAFLEVSGG--SLR 443

  Fly   453 SLSLNQCQITDHG---MLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLS 514
            .|.||  ::.|.|   ...:||....|:.|::..|.|:.:..|:.:....::|:::.|:|.||:.
plant   444 ELCLN--KVRDVGPETAFSLAKVCKMLQFLDLSWCRRLKEDDLRRILRCCSSLQSLKLFGWTQVE 506

  Fly   515 SKGIDIIMKLPKLQKLNLGLWLVRXCVHHD 544
            ...::   :|.:......||.|.. ..|.|
plant   507 DTYLE---ELSRSDVHITGLKLTSLYAHLD 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 1/2 (50%)
AMN1 <226..>334 CDD:187754 31/126 (25%)
leucine-rich repeat 236..256 CDD:275381 2/19 (11%)
leucine-rich repeat 263..288 CDD:275381 8/25 (32%)
leucine-rich repeat 289..314 CDD:275381 10/24 (42%)
leucine-rich repeat 315..347 CDD:275381 8/31 (26%)
AMN1 347..524 CDD:187754 50/211 (24%)
leucine-rich repeat 348..373 CDD:275381 7/36 (19%)
leucine-rich repeat 374..398 CDD:275381 8/24 (33%)
leucine-rich repeat 399..424 CDD:275381 8/24 (33%)
leucine-rich repeat 425..450 CDD:275381 6/27 (22%)
leucine-rich repeat 451..475 CDD:275381 9/26 (35%)
leucine-rich repeat 476..501 CDD:275381 5/24 (21%)
AT5G21900NP_680178.1 AMN1 221..405 CDD:187754 50/189 (26%)
leucine-rich repeat 228..244 CDD:275381 6/15 (40%)
leucine-rich repeat 257..282 CDD:275381 10/24 (42%)
leucine-rich repeat 283..309 CDD:275381 6/25 (24%)
leucine-rich repeat 310..354 CDD:275381 9/49 (18%)
AMN1 <357..507 CDD:187754 42/154 (27%)
leucine-rich repeat 364..389 CDD:275381 8/24 (33%)
leucine-rich repeat 390..415 CDD:275381 8/24 (33%)
leucine-rich repeat 416..441 CDD:275381 6/27 (22%)
leucine-rich repeat 442..467 CDD:275381 9/26 (35%)
leucine-rich repeat 468..493 CDD:275381 5/24 (21%)
leucine-rich repeat 494..516 CDD:275381 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.