DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and SNC1

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001319970.1 Gene:SNC1 / 827397 AraportID:AT4G16890 Length:1437 Species:Arabidopsis thaliana


Alignment Length:383 Identity:92/383 - (24%)
Similarity:155/383 - (40%) Gaps:107/383 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 YAK--SVWKGVEAKLHLKRSSPSLFNCLVKRGIKKVQILSLRRSLKDLVLGVPALTSLNLSGCFN 246
            |:|  .:|:|.     |...|....|......:|::..|||..:|::          |:|.||.:
plant   608 YSKLEKLWEGT-----LPLGSLKEMNLRYSNNLKEIPDLSLAINLEE----------LDLVGCKS 657

  Fly   247 VADMNLGHAFSVDLPN-------LKTLDLSLCKQITD--TSLGRIAQHLRNLETLELGGCCNITN 302
            :          |.||:       |..||:|.||::..  |.|     :|.:||.|.|.||.|:.|
plant   658 L----------VTLPSSIQNATKLIYLDMSDCKKLESFPTDL-----NLESLEYLNLTGCPNLRN 707

  Fly   303 TGLLLIAWGLKKL------KHLNLRSC-WHIS-DQGIGHLAGFSRETAEGNLQLEYLGLQDCQRL 359
              ...|..|...:      ..:.:..| |:.: ..|:.:|...:| ......:.|.|...:.:..
plant   708 --FPAIKMGCSDVDFPEGRNEIVVEDCFWNKNLPAGLDYLDCLTR-CMPCEFRPEQLAFLNVRGY 769

  Fly   360 SDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHLARMPKLEQLNLRSCDNI-------------- 410
            ..|.|....|.|.||:.::||...::|:  :..|::..|||.|.|.:|.::              
plant   770 KHEKLWEGIQSLGSLEGMDLSESENLTE--IPDLSKATKLESLILNNCKSLVTLPSTIGNLHRLV 832

  Fly   411 --------------SDIGMAYLTEGGSGINSLDVSFCDKISDQAL--THIAQGLYRLRSLSLNQC 459
                          :|:.:       |.:.:||:|.|..:....|  |:|. .|| |.:.::.:.
plant   833 RLEMKECTGLEVLPTDVNL-------SSLETLDLSGCSSLRSFPLISTNIV-WLY-LENTAIEEI 888

  Fly   460 QITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAED--LTNLKTIDLYGCTQLSS 515
            ..|       ...||.|..|.:.:|:     ||:.|..|  |::|:|:||.||:.|.|
plant   889 PST-------IGNLHRLVRLEMKKCT-----GLEVLPTDVNLSSLETLDLSGCSSLRS 934

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 2/7 (29%)
AMN1 <226..>334 CDD:187754 30/124 (24%)
leucine-rich repeat 236..256 CDD:275381 4/19 (21%)
leucine-rich repeat 263..288 CDD:275381 9/26 (35%)
leucine-rich repeat 289..314 CDD:275381 10/24 (42%)
leucine-rich repeat 315..347 CDD:275381 5/39 (13%)
AMN1 347..524 CDD:187754 49/201 (24%)
leucine-rich repeat 348..373 CDD:275381 6/24 (25%)
leucine-rich repeat 374..398 CDD:275381 5/23 (22%)
leucine-rich repeat 399..424 CDD:275381 6/52 (12%)
leucine-rich repeat 425..450 CDD:275381 8/26 (31%)
leucine-rich repeat 451..475 CDD:275381 3/23 (13%)
leucine-rich repeat 476..501 CDD:275381 8/26 (31%)
SNC1NP_001319970.1 LRR_3 13..1346 CDD:332712 92/383 (24%)
leucine-rich repeat 579..594 CDD:275380
leucine-rich repeat 601..623 CDD:275380 5/19 (26%)
LRR <619..869 CDD:227223 63/286 (22%)
leucine-rich repeat 624..646 CDD:275380 5/21 (24%)
leucine-rich repeat 647..670 CDD:275380 8/42 (19%)
leucine-rich repeat 671..693 CDD:275380 9/26 (35%)
leucine-rich repeat 705..763 CDD:275380 10/60 (17%)
leucine-rich repeat 784..806 CDD:275380 5/23 (22%)
leucine-rich repeat 807..830 CDD:275380 5/22 (23%)
leucine-rich repeat 831..853 CDD:275380 1/28 (4%)
leucine-rich repeat 854..874 CDD:275380 5/19 (26%)
leucine-rich repeat 875..897 CDD:275380 6/30 (20%)
leucine-rich repeat 898..920 CDD:275380 8/26 (31%)
leucine-rich repeat 921..941 CDD:275380 8/14 (57%)
leucine-rich repeat 942..963 CDD:275380
leucine-rich repeat 964..987 CDD:275380
leucine-rich repeat 988..1021 CDD:275380
leucine-rich repeat 1022..1054 CDD:275380
leucine-rich repeat 1055..1077 CDD:275380
leucine-rich repeat 1099..1124 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.