DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and VFB3

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_567316.1 Gene:VFB3 / 826171 AraportID:AT4G07400 Length:554 Species:Arabidopsis thaliana


Alignment Length:448 Identity:102/448 - (22%)
Similarity:172/448 - (38%) Gaps:105/448 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 HISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSS------PSLF 206
            :||||..|.|..||:.|...||.|.:.||..|      .::......:|.||..|      ||||
plant    73 YISNLPDECLSLIFQSLTCADLKRCSLVCRRW------LTIEGQCRHRLSLKAQSDLISVIPSLF 131

  Fly   207 NCLVKRGIKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLC 271
            ...  ..:.|:.:.|.|||     ||:          |.|...|     .||...||..|.|..|
plant   132 TRF--DSVTKLVLRSDRRS-----LGI----------CDNAFVM-----ISVRCRNLTRLKLRGC 174

  Fly   272 KQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLAG 336
            .:|:|..:....::.|:|:.:..|.|           .:|:|.:..| |.:|..:.:..:..|.|
plant   175 PEISDLGIIGFTENCRSLKKVSFGSC-----------GFGVKGMNAL-LNTCLGLEELSVKRLRG 227

  Fly   337 FSRET-------AEGNLQ----------------------LEYLGLQDCQRLSDEALGHIAQGLT 372
            .....       |.|:|:                      |..|.:..|....|.....:...:.
plant   228 IGAGAELIGPGGAAGSLKVICLKELHNGQCFAPLLSGAKGLRILKIFRCSGDWDRVFEAVRDKVN 292

  Fly   373 SLKSINLSFCVSVTDSGLKHLARMPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVS--FCDK 435
            ::..|:|. .:.::|.||..|::...:|.|:|....:.:::|:|.:.|....:..|.:.  ..::
plant   293 AIVEIHLE-RIQMSDLGLTALSKCSGVEVLHLVKTPDCTNVGLALVAERCKLLRKLHIDGWKTNR 356

  Fly   436 ISDQALTHIAQGLYRLRSLSL--------------NQC------------QITDHGMLKIAKALH 474
            |.|:.|..:|:..:.|:.|.|              :.|            .:.|..:..||:...
plant   357 IGDEGLIVVAKYCWNLQELVLIGVNPTKLSLEAIVSNCLNLERLALCGSDTVGDTELCCIAEKCL 421

  Fly   475 ELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSKGIDIIMKLPKLQKLNL 532
            .|..|.|..|. |||.|::.|.....||..:.:..|..::::|.|::.|...|..:||
plant   422 ALRKLCIKNCP-ITDDGIKALGNGCPNLLKVKVKKCRGVTTQGADLLRKRRALLVVNL 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 15/40 (38%)
AMN1 <226..>334 CDD:187754 23/107 (21%)
leucine-rich repeat 236..256 CDD:275381 3/19 (16%)
leucine-rich repeat 263..288 CDD:275381 6/24 (25%)
leucine-rich repeat 289..314 CDD:275381 4/24 (17%)
leucine-rich repeat 315..347 CDD:275381 7/38 (18%)
AMN1 347..524 CDD:187754 42/226 (19%)
leucine-rich repeat 348..373 CDD:275381 4/24 (17%)
leucine-rich repeat 374..398 CDD:275381 6/23 (26%)
leucine-rich repeat 399..424 CDD:275381 6/24 (25%)
leucine-rich repeat 425..450 CDD:275381 5/26 (19%)
leucine-rich repeat 451..475 CDD:275381 7/49 (14%)
leucine-rich repeat 476..501 CDD:275381 9/24 (38%)
VFB3NP_567316.1 F-box-like 74..>104 CDD:289689 14/29 (48%)
leucine-rich repeat 89..114 CDD:275381 7/30 (23%)
leucine-rich repeat 115..165 CDD:275381 20/71 (28%)
AMN1 <146..>226 CDD:187754 26/111 (23%)
leucine-rich repeat 166..191 CDD:275381 6/24 (25%)
leucine-rich repeat 192..216 CDD:275381 8/35 (23%)
leucine-rich repeat 268..293 CDD:275381 4/24 (17%)
leucine-rich repeat 294..317 CDD:275381 6/23 (26%)
leucine-rich repeat 318..343 CDD:275381 6/24 (25%)
AMN1 <340..>463 CDD:187754 24/123 (20%)
leucine-rich repeat 344..371 CDD:275381 5/26 (19%)
leucine-rich repeat 372..396 CDD:275381 4/23 (17%)
leucine-rich repeat 397..422 CDD:275381 3/24 (13%)
leucine-rich repeat 423..447 CDD:275381 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.