DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and AT4G05470

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001319875.1 Gene:AT4G05470 / 825897 AraportID:AT4G05470 Length:306 Species:Arabidopsis thaliana


Alignment Length:271 Identity:74/271 - (27%)
Similarity:117/271 - (43%) Gaps:47/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 NLFPELLEQIFEHLPVRD-LGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRGI 214
            :|.|||...|...|.:.| |..|.:||..||......|:|:.:..:           :||    :
plant    48 DLPPELTTSILLRLSLTDILDNAQKVCKEWRRICKDPSMWRKINTR-----------DCL----M 97

  Fly   215 KKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLP-NLKTLDLSLC-KQITDT 277
            .....:|:.|.:.||..|  .|..:|:...| ::|..|  ::..|.. ||::|.|.:| .::|..
plant    98 YNFDFVSMCRHIVDLSQG--GLLEINVDEHF-LSDSLL--SYITDRSRNLRSLGLGMCFPRVTKL 157

  Fly   278 SLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRS---CWHISDQGIGHLAGFSR 339
            .:......:..|||||:...|  ....|..|.....:||.|.|.|   .|..||:          
plant   158 GVVNAIAKIPLLETLEVTHSC--IKLDLKAIGHACPQLKTLKLNSLGRLWPASDK---------- 210

  Fly   340 ETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLKH-LARMPKLEQLN 403
              .:.|: |:.:|..:|   .|:||. ||:.:..|..:.| ....:|::||.. |...|.||.|:
plant   211 --YDSNV-LDDMGPLEC---DDDALA-IAESMPKLHHLQL-MANRLTNTGLNAILDGCPHLEHLD 267

  Fly   404 LRSCDNISDIG 414
            :|.|..||.:|
plant   268 VRKCFRISLVG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 14/39 (36%)
AMN1 <226..>334 CDD:187754 31/112 (28%)
leucine-rich repeat 236..256 CDD:275381 5/19 (26%)
leucine-rich repeat 263..288 CDD:275381 5/25 (20%)
leucine-rich repeat 289..314 CDD:275381 8/24 (33%)
leucine-rich repeat 315..347 CDD:275381 9/34 (26%)
AMN1 347..524 CDD:187754 23/69 (33%)
leucine-rich repeat 348..373 CDD:275381 8/24 (33%)
leucine-rich repeat 374..398 CDD:275381 6/24 (25%)
leucine-rich repeat 399..424 CDD:275381 8/16 (50%)
leucine-rich repeat 425..450 CDD:275381
leucine-rich repeat 451..475 CDD:275381
leucine-rich repeat 476..501 CDD:275381
AT4G05470NP_001319875.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.