DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and AT4G03630

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_192272.1 Gene:AT4G03630 / 825663 AraportID:AT4G03630 Length:220 Species:Arabidopsis thaliana


Alignment Length:185 Identity:55/185 - (29%)
Similarity:82/185 - (44%) Gaps:33/185 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 SDEALGHIAQGLTSLKSINLSFCVSV----------------TDSGLKHLA-RMPKLEQLNLRSC 407
            :||.|..:|...:.||.:....|.:|                |||.|.::| |...|..|.|..|
plant     8 ADELLTFVAYRSSILKRLGRMMCHAVALSQGGCVEINIEHFGTDSLLTYIADRSSNLRHLGLAKC 72

  Fly   408 DNISDIGMAYLTEGGS--GINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQCQ-------ITD 463
            |.|:  ||...||...  .:..|::|:| .|..:.|..|......|::|.|| ||       ..|
plant    73 DQIT--GMGLFTEAMKLPLLEDLELSYC-LIKGKNLEAIGFACLHLKTLKLN-CQGFKFPGFTYD 133

  Fly   464 HGMLKIAKALHELENLNI-GQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSKG 517
            |..|.|||.:.||..|.: |  :|::|.||..:.:...:|:.:||..|..::..|
plant   134 HDALGIAKRMPELRCLQLFG--NRVSDVGLNAIFDGCPHLEHLDLRQCFNINLVG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689
AMN1 <226..>334 CDD:187754
leucine-rich repeat 236..256 CDD:275381
leucine-rich repeat 263..288 CDD:275381
leucine-rich repeat 289..314 CDD:275381
leucine-rich repeat 315..347 CDD:275381
AMN1 347..524 CDD:187754 55/185 (30%)
leucine-rich repeat 348..373 CDD:275381 4/12 (33%)
leucine-rich repeat 374..398 CDD:275381 10/40 (25%)
leucine-rich repeat 399..424 CDD:275381 10/26 (38%)
leucine-rich repeat 425..450 CDD:275381 6/24 (25%)
leucine-rich repeat 451..475 CDD:275381 12/30 (40%)
leucine-rich repeat 476..501 CDD:275381 7/25 (28%)
AT4G03630NP_192272.1 AMN1 <39..179 CDD:187754 45/145 (31%)
leucine-rich repeat 64..89 CDD:275381 10/26 (38%)
leucine-rich repeat 90..114 CDD:275381 6/24 (25%)
leucine-rich repeat 115..145 CDD:275381 12/30 (40%)
leucine-rich repeat 146..170 CDD:275381 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.