DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and TIR1

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_567135.1 Gene:TIR1 / 825473 AraportID:AT3G62980 Length:594 Species:Arabidopsis thaliana


Alignment Length:433 Identity:95/433 - (21%)
Similarity:159/433 - (36%) Gaps:119/433 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 FP-ELLEQIFEHLPV-RDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRGIK 215
            || |:||.:|..:.: :|....:.||.:|    |....|         .|....:.||...    
plant     9 FPEEVLEHVFSFIQLDKDRNSVSLVCKSW----YEIERW---------CRRKVFIGNCYAV---- 56

  Fly   216 KVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNL------GHAFSVDLPNLKTLDLSLC--- 271
                     |...::...|.:.|:.|.|..:.||.||      |:.:    |.::.:..|..   
plant    57 ---------SPATVIRRFPKVRSVELKGKPHFADFNLVPDGWGGYVY----PWIEAMSSSYTWLE 108

  Fly   272 ------KQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQG 330
                  ..:||..|..||:..:|.:.|.|..|...:..||..||...:.||.|:||.        
plant   109 EIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRE-------- 165

  Fly   331 IGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVS-VTDSGLKHL- 393
                                   .|...:|...|.|.....|||.|:|:|...| |:.|.|:.| 
plant   166 -----------------------SDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLV 207

  Fly   394 ARMPKLEQLNLRSCDNISDIG--------MAYLTEGG----------SGINSLDVSFCDKISD-- 438
            .|.|.|:.|.|.....:..:.        :..|..||          ||: |:.:|.|.::..  
plant   208 TRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGL-SVALSGCKELRCLS 271

  Fly   439 ---QALTHIAQGLY----RLRSLSLNQCQITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLA 496
               .|:......:|    ||.:|:|:...:..:.::|:.....:|:.|.:  ...|.|.||:.||
plant   272 GFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLWV--LDYIEDAGLEVLA 334

  Fly   497 EDLTNLKTIDLYGC--------TQLSSKG-IDIIMKLPKLQKL 530
            ....:|:.:.::..        ..|:.:| :.:.|..|||:.:
plant   335 STCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 11/38 (29%)
AMN1 <226..>334 CDD:187754 29/122 (24%)
leucine-rich repeat 236..256 CDD:275381 8/25 (32%)
leucine-rich repeat 263..288 CDD:275381 6/33 (18%)
leucine-rich repeat 289..314 CDD:275381 7/24 (29%)
leucine-rich repeat 315..347 CDD:275381 5/31 (16%)
AMN1 347..524 CDD:187754 47/214 (22%)
leucine-rich repeat 348..373 CDD:275381 4/24 (17%)
leucine-rich repeat 374..398 CDD:275381 10/25 (40%)
leucine-rich repeat 399..424 CDD:275381 6/42 (14%)
leucine-rich repeat 425..450 CDD:275381 5/33 (15%)
leucine-rich repeat 451..475 CDD:275381 4/23 (17%)
leucine-rich repeat 476..501 CDD:275381 8/24 (33%)
TIR1NP_567135.1 F-box_5 8..47 CDD:408301 13/50 (26%)
Transp_inhibit 66..112 CDD:408562 11/49 (22%)
leucine-rich repeat 107..131 CDD:275381 5/23 (22%)
AMN1 <116..>224 CDD:187754 38/138 (28%)
leucine-rich repeat 132..157 CDD:275381 7/24 (29%)
leucine-rich repeat 158..212 CDD:275381 21/84 (25%)
leucine-rich repeat 213..286 CDD:275381 12/73 (16%)
AMN1 286..>400 CDD:187754 20/94 (21%)
leucine-rich repeat 291..315 CDD:275381 4/23 (17%)
leucine-rich repeat 316..339 CDD:275381 8/24 (33%)
leucine-rich repeat 340..373 CDD:275381 4/32 (13%)
leucine-rich repeat 374..398 CDD:275381 1/4 (25%)
leucine-rich repeat 399..433 CDD:275381
leucine-rich repeat 434..457 CDD:275381
leucine-rich repeat 458..482 CDD:275381
leucine-rich repeat 483..507 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.