DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and FBL17

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_567005.2 Gene:FBL17 / 824630 AraportID:AT3G54650 Length:593 Species:Arabidopsis thaliana


Alignment Length:436 Identity:102/436 - (23%)
Similarity:166/436 - (38%) Gaps:115/436 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 LEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVE-------------------------AKL 196
            |.::.:.||...|..||:||..||:.  ::.:||..|                         .:|
plant   140 LWEVLKRLPPSSLLMAARVCKGWRET--SRKMWKAAEELRIRVPERAQIGYIGSLLQKCPRLIRL 202

  Fly   197 HLKRSSP--------SLFNCLVKRGIKKVQILSLRRS-----------LKDLVLGVPALTSLNLS 242
            .||..|.        ..|:|      ..:::|.:..|           |...|.....||||.:.
plant   203 SLKIESDFDATTLACIAFSC------PNLEVLEITTSGAAVNRISGDELSRFVANKRGLTSLKME 261

  Fly   243 GCFNVADMNLG------------HAFS---VDLPNLKTLDLSLCKQITDTS--------LGRIAQ 284
            ||.|:...:|.            |:.|   .:.|||..:.|...:|..|::        |||...
plant   262 GCSNLGGFSLSSSSLSTLWLSDLHSLSKMIFNCPNLTEISLEFSRQEDDSTDLVTMVDGLGRTCT 326

  Fly   285 HLRNLETLELGGCCNITNTGLL-LIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQL 348
            .|:|:....|    .:::|.:| |.|...:.|:.|:|....:|:|..:..:       :.|...|
plant   327 RLQNIHIASL----KLSHTVVLSLTAVNFRYLRMLSLVLGINITDASVAAI-------SSGYKNL 380

  Fly   349 EYLGLQDCQRLSDEALGHIAQGL-TSLKSINLSFCVSVTDSGLKH-LARMPKLEQLNLRSCDNIS 411
            |.|.|.. ..::|..||.|...| .:|..:.::.|.::|.||::. .|::|.||         :.
plant   381 ELLDLSG-SSITDTGLGMICDVLPDTLSKLLVALCPNITSSGIQFATAQLPLLE---------LM 435

  Fly   412 DIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLY----RLRSLSLNQCQITDHGMLKIAKA 472
            |.||..     |..||.:.:|.:..|........|.::    ||:.|||..|...|...|...  
plant   436 DCGMTV-----SDPNSDNPTFVENPSPHKTPGYNQKMFIKHKRLKKLSLWGCSSLDALFLNCP-- 493

  Fly   473 LHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSKGI 518
              ||.:||:..||.:..   ::|......|:.:...||..|.:..|
plant   494 --ELMDLNLNLCSNLHP---ESLVLQCPKLQLVYASGCQGLLTGAI 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 10/32 (31%)
AMN1 <226..>334 CDD:187754 33/131 (25%)
leucine-rich repeat 236..256 CDD:275381 9/31 (29%)
leucine-rich repeat 263..288 CDD:275381 8/32 (25%)
leucine-rich repeat 289..314 CDD:275381 5/25 (20%)
leucine-rich repeat 315..347 CDD:275381 6/31 (19%)
AMN1 347..524 CDD:187754 47/178 (26%)
leucine-rich repeat 348..373 CDD:275381 9/25 (36%)
leucine-rich repeat 374..398 CDD:275381 6/24 (25%)
leucine-rich repeat 399..424 CDD:275381 5/24 (21%)
leucine-rich repeat 425..450 CDD:275381 5/28 (18%)
leucine-rich repeat 451..475 CDD:275381 7/23 (30%)
leucine-rich repeat 476..501 CDD:275381 6/24 (25%)
FBL17NP_567005.2 leucine-rich repeat 199..224 CDD:275381 6/30 (20%)
leucine-rich repeat 225..254 CDD:275381 4/28 (14%)
leucine-rich repeat 255..296 CDD:275381 10/40 (25%)
AMN1 <292..437 CDD:187754 40/165 (24%)
leucine-rich repeat 297..327 CDD:275381 7/29 (24%)
leucine-rich repeat 328..353 CDD:275381 7/28 (25%)
leucine-rich repeat 354..379 CDD:275381 6/31 (19%)
leucine-rich repeat 380..405 CDD:275381 9/25 (36%)
leucine-rich repeat 406..430 CDD:275381 6/23 (26%)
leucine-rich repeat 474..494 CDD:275381 7/23 (30%)
leucine-rich repeat 495..517 CDD:275381 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.