DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and AT3G44630

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_850655.1 Gene:AT3G44630 / 823589 AraportID:AT3G44630 Length:1240 Species:Arabidopsis thaliana


Alignment Length:428 Identity:100/428 - (23%)
Similarity:161/428 - (37%) Gaps:126/428 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 KSVWKGVEAKLHLK-------RSSPSLFNCLVKRGIKKVQILSLRRSLKDLVLGVPALTSLNLSG 243
            :.:|:|.:...:||       |....|.:.:.|  :..:|||.| |....||...|::.:.||.|
plant   729 RKLWEGTKQLRNLKWMDLSDSRDLKELPSSIEK--LTSLQILDL-RDCSSLVKLPPSINANNLQG 790

  Fly   244 -----C------------FNVADMNLGHAFS-VDLP-------NLKTLDLSLCKQIT--DTSLGR 281
                 |            .|:..:.|.:..| ::||       ||..||:..|..:.  .:|:| 
plant   791 LSLTNCSRVVKLPAIENVTNLHQLKLQNCSSLIELPLSIGTANNLWKLDIRGCSSLVKLPSSIG- 854

  Fly   282 IAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGN- 345
               .:.||:..:|..|.|:..  |......|:||..|.:|.|..:             ||...| 
plant   855 ---DMTNLKEFDLSNCSNLVE--LPSSIGNLQKLFMLRMRGCSKL-------------ETLPTNI 901

  Fly   346 --LQLEYLGLQDCQRLSD--EALGHIAQ----GLTSLKSINLSFCVSVTDSGLKHLARMPKLEQL 402
              :.|..|.|.||.:|..  |...||::    | |::|.:.|    |:|......:..|...|.|
plant   902 NLISLRILDLTDCSQLKSFPEISTHISELRLKG-TAIKEVPL----SITSWSRLAVYEMSYFESL 961

  Fly   403 N--LRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQCQITDHG 465
            .  ..:.|.|:|:.:.          |.|:        |.:....:.:.|||:|.||.|    :.
plant   962 KEFPHALDIITDLLLV----------SEDI--------QEVPPWVKRMSRLRALRLNNC----NS 1004

  Fly   466 MLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLY--GCTQLSSKGIDIIM------ 522
            ::.:.:....|:.:....|     |.|:.| :...|...|.||  .|.:|:.:..|:||      
plant  1005 LVSLPQLPDSLDYIYADNC-----KSLERL-DCCFNNPEIRLYFPKCFKLNQEARDLIMHTSTRK 1063

  Fly   523 --KLPKLQKLNLGLWLVRXCVHHDCNACAAKEAARGSY 558
              .||.:|        |. |.:|        .|..|.|
plant  1064 YAMLPSIQ--------VPACFNH--------RATSGDY 1085

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 0/3 (0%)
AMN1 <226..>334 CDD:187754 31/134 (23%)
leucine-rich repeat 236..256 CDD:275381 6/36 (17%)
leucine-rich repeat 263..288 CDD:275381 6/26 (23%)
leucine-rich repeat 289..314 CDD:275381 6/24 (25%)
leucine-rich repeat 315..347 CDD:275381 7/34 (21%)
AMN1 347..524 CDD:187754 45/194 (23%)
leucine-rich repeat 348..373 CDD:275381 10/30 (33%)
leucine-rich repeat 374..398 CDD:275381 5/23 (22%)
leucine-rich repeat 399..424 CDD:275381 5/26 (19%)
leucine-rich repeat 425..450 CDD:275381 3/24 (13%)
leucine-rich repeat 451..475 CDD:275381 6/23 (26%)
leucine-rich repeat 476..501 CDD:275381 5/24 (21%)
AT3G44630NP_850655.1 PLN03210 89..1107 CDD:215633 100/428 (23%)
TIR 94..259 CDD:279864
AAA 283..411 CDD:99707
LRR_3 717..736 CDD:285026 2/6 (33%)
leucine-rich repeat 741..764 CDD:275380 5/24 (21%)
leucine-rich repeat 765..787 CDD:275380 8/22 (36%)
leucine-rich repeat 788..810 CDD:275380 3/21 (14%)
AMN1 809..974 CDD:187754 47/188 (25%)
leucine-rich repeat 811..845 CDD:275380 9/33 (27%)
leucine-rich repeat 859..882 CDD:275380 6/24 (25%)
leucine-rich repeat 883..905 CDD:275380 7/34 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.