DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and AFB2

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_566800.1 Gene:AFB2 / 822296 AraportID:AT3G26810 Length:575 Species:Arabidopsis thaliana


Alignment Length:421 Identity:102/421 - (24%)
Similarity:175/421 - (41%) Gaps:81/421 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 NLFP-ELLEQIFEHLPV-RDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRG 213
            |.|| |::|.:|:.:.. :|....:.||.:|         :| :|   ...|....:.||.   .
plant     2 NYFPDEVIEHVFDFVTSHKDRNAISLVCKSW---------YK-IE---RYSRQKVFIGNCY---A 50

  Fly   214 IKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNL-GHAF-SVDLPNLKTL--------DL 268
            |...::  |||        .|.|.||.|.|..:.||.|| .|.: ...||.::.|        :|
plant    51 INPERL--LRR--------FPCLKSLTLKGKPHFADFNLVPHEWGGFVLPWIEALARSRVGLEEL 105

  Fly   269 SLCKQ-ITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIG 332
            .|.:. :||.||..:::...|.::|.|..|...|..||..||...:.|:.|:|:.. .|.|....
plant   106 RLKRMVVTDESLELLSRSFVNFKSLVLVSCEGFTTDGLASIAANCRHLRDLDLQEN-EIDDHRGQ 169

  Fly   333 HLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHLARMP 397
            .|:.|. :|....:.|.:..|:....|  .||..:.....:|||:.|:..|.: |:..:.:|..|
plant   170 WLSCFP-DTCTTLVTLNFACLEGETNL--VALERLVARSPNLKSLKLNRAVPL-DALARLMACAP 230

  Fly   398 KLEQLNLRSCDNISDIG-----MAYLTEGGS-----------------------GINSLDVSFCD 434
            ::..|.:.|.:|..|..     ||.:.:..|                       .:.||::|:..
plant   231 QIVDLGVGSYENDPDSESYLKLMAVIKKCTSLRSLSGFLEAAPHCLSAFHPICHNLTSLNLSYAA 295

  Fly   435 KISDQALTHIAQGLYRLRSLSLNQCQITDHGMLKIAKALHELENLNI-------GQCSRITDKGL 492
            :|....|..:.|...:|:.|.:.. .|.|.|:..:|....||:.|.:       |..:.:|::||
plant   296 EIHGSHLIKLIQHCKKLQRLWILD-SIGDKGLEVVASTCKELQELRVFPSDLLGGGNTAVTEEGL 359

  Fly   493 QTLAEDLTNLKTIDLYGCTQLSSKGIDIIMK 523
            ..::.....|.:| ||.|.|:::..:..:.|
plant   360 VAISAGCPKLHSI-LYFCQQMTNAALVTVAK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 10/40 (25%)
AMN1 <226..>334 CDD:187754 34/118 (29%)
leucine-rich repeat 236..256 CDD:275381 10/20 (50%)
leucine-rich repeat 263..288 CDD:275381 7/33 (21%)
leucine-rich repeat 289..314 CDD:275381 8/24 (33%)
leucine-rich repeat 315..347 CDD:275381 8/31 (26%)
AMN1 347..524 CDD:187754 46/212 (22%)
leucine-rich repeat 348..373 CDD:275381 5/24 (21%)
leucine-rich repeat 374..398 CDD:275381 7/23 (30%)
leucine-rich repeat 399..424 CDD:275381 7/52 (13%)
leucine-rich repeat 425..450 CDD:275381 6/24 (25%)
leucine-rich repeat 451..475 CDD:275381 6/23 (26%)
leucine-rich repeat 476..501 CDD:275381 6/31 (19%)
AFB2NP_566800.1 F-box_5 1..42 CDD:408301 13/52 (25%)
Transp_inhibit 61..107 CDD:408562 15/45 (33%)
leucine-rich repeat 102..126 CDD:275381 6/23 (26%)
AMN1 <111..>219 CDD:187754 31/111 (28%)
leucine-rich repeat 127..152 CDD:275381 8/24 (33%)
leucine-rich repeat 153..207 CDD:275381 13/57 (23%)
leucine-rich repeat 208..261 CDD:275381 14/53 (26%)
leucine-rich repeat 286..311 CDD:275381 6/24 (25%)
AMN1 304..>393 CDD:187754 21/88 (24%)
leucine-rich repeat 312..335 CDD:275381 6/23 (26%)
leucine-rich repeat 336..368 CDD:275381 6/31 (19%)
leucine-rich repeat 369..393 CDD:275381 7/22 (32%)
leucine-rich repeat 394..428 CDD:275381
leucine-rich repeat 429..452 CDD:275381
leucine-rich repeat 453..477 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.