DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and EBF1

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_565597.1 Gene:EBF1 / 817087 AraportID:AT2G25490 Length:628 Species:Arabidopsis thaliana


Alignment Length:395 Identity:107/395 - (27%)
Similarity:180/395 - (45%) Gaps:64/395 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 GVEAKLHLKRS-----SPSLFNC-LVK-RGIK-------------KVQILSLR-----------R 224
            |.|..|.:.||     |.|:.|| ||: :||.             |:|:|::.           .
plant   243 GDEGLLAIARSCSKLKSVSIKNCPLVRDQGIASLLSNTTCSLAKLKLQMLNVTDVSLAVVGHYGL 307

  Fly   225 SLKDLVL------------------GVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLC 271
            |:.||||                  |:..|.||.::.|..|.||.| .:.....||:|...:|..
plant   308 SITDLVLAGLSHVSEKGFWVMGNGVGLQKLNSLTITACQGVTDMGL-ESVGKGCPNMKKAIISKS 371

  Fly   272 KQITDTSLGRIAQHLRNLETLELGGCCNITNTGLL--LIAWGLKKLKHLNLRSCWHISDQGIGHL 334
            ..::|..|...|:...:||:|:|..|..:|..|..  |:..| :|||..:|.:|..|.|...| |
plant   372 PLLSDNGLVSFAKASLSLESLQLEECHRVTQFGFFGSLLNCG-EKLKAFSLVNCLSIRDLTTG-L 434

  Fly   335 AGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHLARMPKL 399
            ...|..:|     |..|.:::|....|..|..|.:....|:.|:|.....:|:||..||.: ..|
plant   435 PASSHCSA-----LRSLSIRNCPGFGDANLAAIGKLCPQLEDIDLCGLKGITESGFLHLIQ-SSL 493

  Fly   400 EQLNLRSCDNISDIGMAYLT-EGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQCQITD 463
            .::|...|.|::|..::.:| ..|..:..|::..|..|:|.:|..||.....|..|.:::|.|:|
plant   494 VKINFSGCSNLTDRVISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISKCAISD 558

  Fly   464 HGMLKIAKA-LHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSKGIDIIMKLPKL 527
            .|:..:|.: ..:|:.|::..||.:|||.|..:....:.|..::|..|..:|:..:|.:::  :|
plant   559 SGIQALASSDKLKLQILSVAGCSMVTDKSLPAIVGLGSTLLGLNLQQCRSISNSTVDFLVE--RL 621

  Fly   528 QKLNL 532
            .|.::
plant   622 YKCDI 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689
AMN1 <226..>334 CDD:187754 37/127 (29%)
leucine-rich repeat 236..256 CDD:275381 8/19 (42%)
leucine-rich repeat 263..288 CDD:275381 5/24 (21%)
leucine-rich repeat 289..314 CDD:275381 9/26 (35%)
leucine-rich repeat 315..347 CDD:275381 10/31 (32%)
AMN1 347..524 CDD:187754 48/178 (27%)
leucine-rich repeat 348..373 CDD:275381 6/24 (25%)
leucine-rich repeat 374..398 CDD:275381 8/23 (35%)
leucine-rich repeat 399..424 CDD:275381 7/25 (28%)
leucine-rich repeat 425..450 CDD:275381 7/24 (29%)
leucine-rich repeat 451..475 CDD:275381 7/24 (29%)
leucine-rich repeat 476..501 CDD:275381 8/24 (33%)
EBF1NP_565597.1 F-box-like 64..101 CDD:372399
AMN1 <149..298 CDD:187754 16/54 (30%)
leucine-rich repeat 179..204 CDD:275381
leucine-rich repeat 205..230 CDD:275381
leucine-rich repeat 231..256 CDD:275381 5/12 (42%)
leucine-rich repeat 257..283 CDD:275381 8/25 (32%)
leucine-rich repeat 284..308 CDD:275381 3/23 (13%)
leucine-rich repeat 309..336 CDD:275381 5/26 (19%)
leucine-rich repeat 337..362 CDD:275381 8/25 (32%)
leucine-rich repeat 363..388 CDD:275381 5/24 (21%)
leucine-rich repeat 416..442 CDD:275381 9/26 (35%)
AMN1 440..611 CDD:187754 47/176 (27%)
leucine-rich repeat 443..468 CDD:275381 6/24 (25%)
leucine-rich repeat 469..492 CDD:275381 8/23 (35%)
leucine-rich repeat 493..519 CDD:275381 7/25 (28%)
leucine-rich repeat 520..545 CDD:275381 7/24 (29%)
leucine-rich repeat 546..571 CDD:275381 7/24 (29%)
leucine-rich repeat 572..591 CDD:275381 8/18 (44%)
leucine-rich repeat 598..619 CDD:275381 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.