DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and fbxl16

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001188265.1 Gene:fbxl16 / 797939 ZFINID:ZDB-GENE-120215-180 Length:493 Species:Danio rerio


Alignment Length:515 Identity:131/515 - (25%)
Similarity:214/515 - (41%) Gaps:103/515 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GGAAIGGAGAGGAPSWAMDELYQQTELPGLTRTGATTTHHHLLRFTPYALHHRPPHHQLQTLPPA 101
            |.|:|    ..|.|: |.:.|.|.:.:|.:              ..|.:|    |:| |..||.|
Zfish    37 GSASI----TKGTPA-AKNRLCQSSSVPTI--------------LPPPSL----PYH-LDPLPTA 77

  Fly   102 LYLQHAAAAAAAAAAAAAHAQHHHHHHHHLPHRPASPESPPPVEGTHISNLFPELLEQIFEHLPV 166
            ..|.......:...|.                :|...:.|.|:....:. |..::|.::..:...
Zfish    78 ASLLGPDLDTSPVTAI----------------KPPLRQFPKPLLERQLI-LDEKVLNRLLWYFTT 125

  Fly   167 RDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFN-------------------CLV-- 210
            .:....||||..||...|....|:||...||.|.....|.|                   |||  
Zfish   126 AEKCILAQVCKTWRKVLYQPKFWEGVTPILHAKELYTILPNGEKEFVSLQAFALRGFQAFCLVGV 190

  Fly   211 ---------------KRGIKKVQILSLRRS------LKDLVLGVPALTSLNLSGCFNVADMNLGH 254
                           |:|:|.|   ||:||      |:.::..:..|..|.||||.:..:..|..
Zfish   191 SDLDICEFIDNYPLSKKGVKSV---SLKRSTITDAGLEVMLEQMQGLMHLELSGCNDFTEAGLWS 252

  Fly   255 AFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKH-L 318
            :.:..|.:|...|   |..:.|.::..|:|.|.||..|.| ...::|:|.:...........| |
Zfish   253 SLNARLTSLSVSD---CINVADDAIAAISQLLPNLSELSL-QAYHVTDTAMAYFTAKQGYTTHTL 313

  Fly   319 NLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCV 383
            .|.|||.|::.|:.::       ......|..|.|..|.:::|:.:..:|:.|..|:|::||:|.
Zfish   314 RLNSCWEITNHGVVNM-------VHSLPNLTSLSLSGCSKITDDGVELVAENLRKLRSLDLSWCP 371

  Fly   384 SVTDSGLKHLA-RMPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQG 447
            .:||..|:::| .:.|||:|.|..|..|:|.|:.||:. .|.:.||.:.:|.::.|..|.|: .|
Zfish   372 RITDMALEYIACDLHKLEELVLDRCVRITDTGLGYLST-MSTLRSLYLRWCCQVQDFGLQHL-YG 434

  Fly   448 LYRLRSLSLNQCQ-ITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTID 506
            :..||.|||..|. :|..|:..:.: |.:||.|.:..|...|.:..:..::.|.....|:
Zfish   435 MRSLRLLSLAGCPLLTTTGLSGLIQ-LQDLEELELTNCPGATAELFKYYSQHLPRCMVIE 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 9/40 (23%)
AMN1 <226..>334 CDD:187754 30/108 (28%)
leucine-rich repeat 236..256 CDD:275381 7/19 (37%)
leucine-rich repeat 263..288 CDD:275381 7/24 (29%)
leucine-rich repeat 289..314 CDD:275381 5/24 (21%)
leucine-rich repeat 315..347 CDD:275381 8/32 (25%)
AMN1 347..524 CDD:187754 51/162 (31%)
leucine-rich repeat 348..373 CDD:275381 7/24 (29%)
leucine-rich repeat 374..398 CDD:275381 9/24 (38%)
leucine-rich repeat 399..424 CDD:275381 10/24 (42%)
leucine-rich repeat 425..450 CDD:275381 7/24 (29%)
leucine-rich repeat 451..475 CDD:275381 9/24 (38%)
leucine-rich repeat 476..501 CDD:275381 6/24 (25%)
fbxl16NP_001188265.1 leucine-rich repeat 209..233 CDD:275381 7/26 (27%)
AMN1 215..446 CDD:187754 72/243 (30%)
leucine-rich repeat 234..253 CDD:275381 7/18 (39%)
leucine-rich repeat 258..283 CDD:275381 8/27 (30%)
leucine-rich repeat 284..308 CDD:275381 5/24 (21%)
leucine-rich repeat 309..335 CDD:275381 8/32 (25%)
leucine-rich repeat 336..361 CDD:275381 7/24 (29%)
leucine-rich repeat 362..387 CDD:275381 9/24 (38%)
leucine-rich repeat 388..412 CDD:275381 10/24 (42%)
leucine-rich repeat 413..437 CDD:275381 7/24 (29%)
leucine-rich repeat 438..457 CDD:275381 8/18 (44%)
leucine-rich repeat 463..488 CDD:275381 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.