| Sequence 1: | NP_001261138.1 | Gene: | Ppa / 37602 | FlyBaseID: | FBgn0020257 | Length: | 562 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_780415.1 | Gene: | Fbxl22 / 74165 | MGIID: | 1921415 | Length: | 236 | Species: | Mus musculus |
| Alignment Length: | 208 | Identity: | 62/208 - (29%) |
|---|---|---|---|
| Similarity: | 92/208 - (44%) | Gaps: | 27/208 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 148 HISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVW------KGVEAKLHLKRSSPSLF 206
Fly 207 NCLVKRGIKKVQILS--------LRRSL--------KDLVLGV----PALTSLNLSGCFNVADMN 251
Fly 252 LGHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLK 316
Fly 317 HLNLRSCWHISDQ 329 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ppa | NP_001261138.1 | F-box-like | 149..190 | CDD:289689 | 10/46 (22%) |
| AMN1 | <226..>334 | CDD:187754 | 39/116 (34%) | ||
| leucine-rich repeat | 236..256 | CDD:275381 | 10/19 (53%) | ||
| leucine-rich repeat | 263..288 | CDD:275381 | 9/24 (38%) | ||
| leucine-rich repeat | 289..314 | CDD:275381 | 8/24 (33%) | ||
| leucine-rich repeat | 315..347 | CDD:275381 | 6/15 (40%) | ||
| AMN1 | 347..524 | CDD:187754 | |||
| leucine-rich repeat | 348..373 | CDD:275381 | |||
| leucine-rich repeat | 374..398 | CDD:275381 | |||
| leucine-rich repeat | 399..424 | CDD:275381 | |||
| leucine-rich repeat | 425..450 | CDD:275381 | |||
| leucine-rich repeat | 451..475 | CDD:275381 | |||
| leucine-rich repeat | 476..501 | CDD:275381 | |||
| Fbxl22 | NP_780415.1 | F-box-like | 3..43 | CDD:403981 | 9/39 (23%) |
| LRR 1 | 15..40 | 5/24 (21%) | |||
| LRR 2 | 43..72 | 7/28 (25%) | |||
| AMN1 | 45..>200 | CDD:187754 | 46/155 (30%) | ||
| LRR 3 | 98..123 | 8/24 (33%) | |||
| leucine-rich repeat | 116..141 | CDD:275381 | 10/25 (40%) | ||
| LRR 4 | 124..149 | 9/25 (36%) | |||
| leucine-rich repeat | 142..167 | CDD:275381 | 9/24 (38%) | ||
| LRR 5 | 150..175 | 9/24 (38%) | |||
| leucine-rich repeat | 168..193 | CDD:275381 | 8/24 (33%) | ||
| LRR 6 | 176..201 | 6/24 (25%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||