DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Fbxl20

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_006534361.1 Gene:Fbxl20 / 72194 MGIID:1919444 Length:438 Species:Mus musculus


Alignment Length:393 Identity:122/393 - (31%)
Similarity:187/393 - (47%) Gaps:55/393 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 ELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRGI--KKV 217
            |||.:||..|.|..|.|.|||..||...|...|.|:.::           ||:  .:|.|  :.|
Mouse    33 ELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRID-----------LFD--FQRDIEGRVV 84

  Fly   218 QILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITD---TSL 279
            :.:|.|..        ..|..|:|.||..|.| |....|:.:..|::.|.|:.|.:.||   |||
Mouse    85 ENISKRCG--------GFLRKLSLRGCLGVGD-NALRTFAQNCRNIEVLSLNGCTKTTDATCTSL 140

  Fly   280 GRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHL----AGFSRE 340
            .:....||:   |:|..|.:|||..|..::.|...|:.||:..|..::..||..|    .|....
Mouse   141 SKFCSKLRH---LDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKAL 202

  Fly   341 TAEGNLQLE-----YLG----------LQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGL 390
            ..:|..|||     |:|          ||.|.:::||.|..|.:|...|:|:..|.|.::||:.|
Mouse   203 FLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAIL 267

  Fly   391 KHLAR-MPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSL 454
            ..|.: .|:|..|.:..|..::|:|...|......:..:|:..|.:|:|..|..::....||:.|
Mouse   268 NALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVL 332

  Fly   455 SLNQCQ-ITDHGMLKI---AKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSS 515
            ||:.|: |||.|:..:   |.|..:||.:.:..|..|||..|:.| :...:|:.|:||.|.|::.
Mouse   333 SLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLEHL-KSCHSLERIELYDCQQITR 396

  Fly   516 KGI 518
            .||
Mouse   397 AGI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 16/34 (47%)
AMN1 <226..>334 CDD:187754 34/110 (31%)
leucine-rich repeat 236..256 CDD:275381 8/19 (42%)
leucine-rich repeat 263..288 CDD:275381 9/27 (33%)
leucine-rich repeat 289..314 CDD:275381 8/24 (33%)
leucine-rich repeat 315..347 CDD:275381 9/35 (26%)
AMN1 347..524 CDD:187754 61/192 (32%)
leucine-rich repeat 348..373 CDD:275381 12/39 (31%)
leucine-rich repeat 374..398 CDD:275381 8/24 (33%)
leucine-rich repeat 399..424 CDD:275381 6/24 (25%)
leucine-rich repeat 425..450 CDD:275381 5/24 (21%)
leucine-rich repeat 451..475 CDD:275381 11/27 (41%)
leucine-rich repeat 476..501 CDD:275381 8/24 (33%)
Fbxl20XP_006534361.1 F-box-like 30..71 CDD:403981 17/37 (46%)
leucine-rich repeat 67..94 CDD:275381 8/47 (17%)
AMN1 95..291 CDD:187754 62/199 (31%)
leucine-rich repeat 95..114 CDD:275381 8/19 (42%)
leucine-rich repeat 121..146 CDD:275381 8/24 (33%)
leucine-rich repeat 147..172 CDD:275381 10/27 (37%)
leucine-rich repeat 173..198 CDD:275381 7/24 (29%)
leucine-rich repeat 199..224 CDD:275381 6/24 (25%)
AMN1 222..396 CDD:187754 54/174 (31%)
leucine-rich repeat 225..250 CDD:275381 8/24 (33%)
leucine-rich repeat 251..276 CDD:275381 8/24 (33%)
leucine-rich repeat 277..302 CDD:275381 6/24 (25%)
leucine-rich repeat 303..328 CDD:275381 5/24 (21%)
leucine-rich repeat 329..357 CDD:275381 11/27 (41%)
leucine-rich repeat 358..382 CDD:275381 8/24 (33%)
leucine-rich repeat 383..408 CDD:275381 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.