DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Fbxo33

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001028328.2 Gene:Fbxo33 / 70611 MGIID:1917861 Length:562 Species:Mus musculus


Alignment Length:548 Identity:123/548 - (22%)
Similarity:170/548 - (31%) Gaps:195/548 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AGAGGAPSWAMDE---LYQQTELPGLTRTGATTTHHHLLRFTPYALHHRPPHHQLQTLPPALYLQ 105
            |||.....|...:   |.|...|.||.|.         ||..|.....||              .
Mouse    19 AGAARLVRWRRRQRLRLLQLRRLRGLLRG---------LRRRPGTGGRRP--------------S 60

  Fly   106 HAAAAAAAAAAAAAHAQHHHHHHHHLPHRPASPESPPPVEGTHISNLFPELLEQIFEHLPVRDLG 170
            ..|....||.||:            ||                     .||:..||..||..|..
Mouse    61 RMALCGQAAGAAS------------LP---------------------SELIVHIFSFLPAPDRL 92

  Fly   171 RAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRGIKKVQILSLRRSLKDLV--LGV 233
            ||:..|:.||:..:..::|             |.|..||.....::.::..|.|.....|  |.|
Mouse    93 RASASCSHWRECLFYPALW-------------PQLRICLRVSPAEQPRLEFLMRKCGWFVRELRV 144

  Fly   234 PALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCC 298
            .......|||.....|...|..                   |||..|.     .:.|.|:|..  
Mouse   145 EFAAENYLSGGGGPGDGGSGGG-------------------TDTGTGG-----EDGEALQLSS-- 183

  Fly   299 NITNTGLLLIAWGLKKLK-HLNLRSCWHISDQGIGHLAGFSR------ETAEGNLQLEYLG---- 352
                      .| |:.|: :|.|..|..:|.:...:|..||.      ...:|:|...||.    
Mouse   184 ----------RW-LEVLRIYLELVLCVLLSIRNNRNLQKFSLFGDISVVHQQGSLSSTYLSRVDP 237

  Fly   353 ----LQDCQRLSDEALGHIAQGLTSLKSINLSFCVS-VTDSGLKHLAR--MPKLEQLNLRSCDNI 410
                ::..|:|.:|.|.:..|    ||.::..|.:. ||.:.|..|:.  ...:|.|:|.. :||
Mouse   238 DGKKIKQIQQLFEEILSNSRQ----LKWLSCGFMLEIVTPTSLSSLSNPIANTMEHLSLLD-NNI 297

  Fly   411 ---SDIGMAYLTEGGSGINSLDVSFCDKISDQA----------------LTHIAQGLYRLRSLS- 455
               |.:..|...|....:.||.:.|||..::.|                |.|.|..:  |:||. 
Mouse   298 PGNSTLITAVELERFVNLRSLALDFCDFTAEMARVLTDSNHVPLQRLSLLVHNASVM--LKSLDN 360

  Fly   456 --------------------LNQCQITDHGMLKIAKALHELENLN------------IGQCSRIT 488
                                |....|....||||.|....||.::            :...||..
Mouse   361 MPNDEHWKALSRKSSSLRVYLMVFDIKSEDMLKILKPSIPLERVHFDSYVTCVSGAIVDLISRQY 425

  Fly   489 DKGLQ--TLAEDLTNLKTIDLYGCTQLS 514
            ||.|.  .|..|:     ||..|...||
Mouse   426 DKFLTHFILMNDM-----IDTSGFPDLS 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 12/40 (30%)
AMN1 <226..>334 CDD:187754 22/110 (20%)
leucine-rich repeat 236..256 CDD:275381 5/19 (26%)
leucine-rich repeat 263..288 CDD:275381 4/24 (17%)
leucine-rich repeat 289..314 CDD:275381 5/24 (21%)
leucine-rich repeat 315..347 CDD:275381 9/38 (24%)
AMN1 347..524 CDD:187754 55/233 (24%)
leucine-rich repeat 348..373 CDD:275381 7/32 (22%)
leucine-rich repeat 374..398 CDD:275381 7/26 (27%)
leucine-rich repeat 399..424 CDD:275381 8/27 (30%)
leucine-rich repeat 425..450 CDD:275381 9/40 (23%)
leucine-rich repeat 451..475 CDD:275381 10/44 (23%)
leucine-rich repeat 476..501 CDD:275381 9/38 (24%)
Fbxo33NP_001028328.2 F-box-like 72..119 CDD:289689 19/92 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..176 6/44 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.