DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Fbxl15

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001365702.1 Gene:Fbxl15 / 68431 MGIID:1915681 Length:336 Species:Mus musculus


Alignment Length:404 Identity:95/404 - (23%)
Similarity:155/404 - (38%) Gaps:137/404 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 LLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRGIKKVQIL 220
            ||..:...:|:|.|.|..:|..|:|           ...:|||.|                    
Mouse    28 LLPHVLNWVPLRQLLRLQRVSRAFR-----------ALVQLHLAR-------------------- 61

  Fly   221 SLRRSLKDLVLGVPALTSLNLSGCFNVADMNLG------HAFSVDLPNLKTLDLSLC-------- 271
             |||                    |:.|.::.|      || ...:|....|..|.|        
Mouse    62 -LRR--------------------FDAAQVSRGPEPRPRHA-PAWVPPSPRLQASPCCAVNPSRP 104

  Fly   272 ---KQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGH 333
               .||...:|.|:.:....|:.|.|..|..                        | :||:.:  
Mouse   105 RVGPQIPRAALARLLRDAEGLQELALAPCHE------------------------W-LSDEDL-- 142

  Fly   334 LAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHLA-RMP 397
            :...:|     |.||..:.|..|.:||..|||.:|:|...|:.::|:.|..|....|:.|| |.|
Mouse   143 VPVLAR-----NPQLRSVALAGCGQLSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLADRCP 202

  Fly   398 KLEQLNLRSCDNISDIGMAYLTE-GGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQCQI 461
            .||:|:|.:|..:.|..:.||.: .|:|:.||                        ||::| ..:
Mouse   203 ALEELDLTACRQLKDEAIVYLAQRRGAGLRSL------------------------SLAVN-ANV 242

  Fly   462 TDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGC--------TQLSSKGI 518
            .|..:.::|:...:||:|::..|.|:...|::||||....|:::.:..|        ::|..:|:
Mouse   243 GDTAVQELARNCPQLEHLDLTGCLRVGSDGVRTLAEYCPALRSLRVRHCHHVAEPSLSRLRKRGV 307

  Fly   519 DIIMKLPKLQKLNL 532
            ||.::.|..|.|.|
Mouse   308 DIDVEPPLHQALVL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 9/33 (27%)
AMN1 <226..>334 CDD:187754 20/124 (16%)
leucine-rich repeat 236..256 CDD:275381 4/25 (16%)
leucine-rich repeat 263..288 CDD:275381 7/35 (20%)
leucine-rich repeat 289..314 CDD:275381 4/24 (17%)
leucine-rich repeat 315..347 CDD:275381 5/31 (16%)
AMN1 347..524 CDD:187754 53/186 (28%)
leucine-rich repeat 348..373 CDD:275381 10/24 (42%)
leucine-rich repeat 374..398 CDD:275381 8/24 (33%)
leucine-rich repeat 399..424 CDD:275381 9/25 (36%)
leucine-rich repeat 425..450 CDD:275381 2/24 (8%)
leucine-rich repeat 451..475 CDD:275381 5/23 (22%)
leucine-rich repeat 476..501 CDD:275381 10/24 (42%)
Fbxl15NP_001365702.1 F-box 18..55 CDD:395521 9/37 (24%)
leucine-rich repeat 125..151 CDD:275381 9/57 (16%)
leucine-rich repeat 152..177 CDD:275381 10/24 (42%)
AMN1 <175..>304 CDD:187754 39/153 (25%)
leucine-rich repeat 178..203 CDD:275381 8/24 (33%)
leucine-rich repeat 204..230 CDD:275381 9/25 (36%)
leucine-rich repeat 231..256 CDD:275381 7/49 (14%)
leucine-rich repeat 257..281 CDD:275381 10/23 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.