Sequence 1: | NP_001261138.1 | Gene: | Ppa / 37602 | FlyBaseID: | FBgn0020257 | Length: | 562 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006516243.1 | Gene: | Dmac2l / 68055 | MGIID: | 1915305 | Length: | 207 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 49/197 - (24%) |
---|---|---|---|
Similarity: | 78/197 - (39%) | Gaps: | 55/197 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 150 SNLFPELLEQIF---EHLPVRDLG--RAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCL 209
Fly 210 VKRGIKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQI 274
Fly 275 TDTSLGRIAQHLRNLE----TLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLA 335
Fly 336 GF 337 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ppa | NP_001261138.1 | F-box-like | 149..190 | CDD:289689 | 14/44 (32%) |
AMN1 | <226..>334 | CDD:187754 | 26/111 (23%) | ||
leucine-rich repeat | 236..256 | CDD:275381 | 4/19 (21%) | ||
leucine-rich repeat | 263..288 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 289..314 | CDD:275381 | 7/28 (25%) | ||
leucine-rich repeat | 315..347 | CDD:275381 | 6/23 (26%) | ||
AMN1 | 347..524 | CDD:187754 | |||
leucine-rich repeat | 348..373 | CDD:275381 | |||
leucine-rich repeat | 374..398 | CDD:275381 | |||
leucine-rich repeat | 399..424 | CDD:275381 | |||
leucine-rich repeat | 425..450 | CDD:275381 | |||
leucine-rich repeat | 451..475 | CDD:275381 | |||
leucine-rich repeat | 476..501 | CDD:275381 | |||
Dmac2l | XP_006516243.1 | AMN1 | 97..>159 | CDD:187754 | 21/64 (33%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |