DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ppa and Dmac2

DIOPT Version :9

Sequence 1:	NP_001261138.1	Gene:	Ppa / 37602	FlyBaseID:	FBgn0020257	Length:	562	Species:	Drosophila melanogaster
Sequence 2:	NP_001277416.1	Gene:	Dmac2 / 66349	MGIID:	1913599	Length:	258	Species:	Mus musculus

Alignment Length:	110	Identity:	33/110 - (30%)
Similarity:	58/110 - (52%)	Gaps:	7/110 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   425 INSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQC-QITDHGMLKIAKALHELENLNIGQCSRIT 488
            :.::|.|.| .|:.|.|:::.. |..||||||.:| .:.|..:.::......|:.|::..|.||:
Mouse   127 VEAVDASGC-AINYQGLSNLLP-LKELRSLSLQRCPNLDDWCLSRLYLLAGSLQELSLAGCPRIS 189

  Fly   489 DKGLQTLAEDLTNLKTIDLYGCTQLSSKGIDIIM---KLPKLQKL 530
            ::||..| ..|.||:.:|:.....:|..|:..|:   .||..:.|
Mouse   190 ERGLACL-HHLQNLRRLDISDLPAVSHPGLTQILVEEMLPHCEVL 233

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ppa	NP_001261138.1	F-box-like	149..190	CDD:289689
		AMN1	<226..>334	CDD:187754
		leucine-rich repeat	236..256	CDD:275381
		leucine-rich repeat	263..288	CDD:275381
		leucine-rich repeat	289..314	CDD:275381
		leucine-rich repeat	315..347	CDD:275381
		AMN1	347..524	CDD:187754	30/102 (29%)
		leucine-rich repeat	348..373	CDD:275381
		leucine-rich repeat	374..398	CDD:275381
		leucine-rich repeat	399..424	CDD:275381
		leucine-rich repeat	425..450	CDD:275381	7/24 (29%)
		leucine-rich repeat	451..475	CDD:275381	8/24 (33%)
		leucine-rich repeat	476..501	CDD:275381	9/24 (38%)
Dmac2	NP_001277416.1	leucine-rich repeat	127..140	CDD:275381	4/13 (31%)
		AMN1	149..>221	CDD:187754	22/72 (31%)
		leucine-rich repeat	151..176	CDD:275381	8/24 (33%)
		leucine-rich repeat	177..201	CDD:275381	9/24 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910