DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Dmac2

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001277416.1 Gene:Dmac2 / 66349 MGIID:1913599 Length:258 Species:Mus musculus


Alignment Length:110 Identity:33/110 - (30%)
Similarity:58/110 - (52%) Gaps:7/110 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 INSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQC-QITDHGMLKIAKALHELENLNIGQCSRIT 488
            :.::|.|.| .|:.|.|:::.. |..||||||.:| .:.|..:.::......|:.|::..|.||:
Mouse   127 VEAVDASGC-AINYQGLSNLLP-LKELRSLSLQRCPNLDDWCLSRLYLLAGSLQELSLAGCPRIS 189

  Fly   489 DKGLQTLAEDLTNLKTIDLYGCTQLSSKGIDIIM---KLPKLQKL 530
            ::||..| ..|.||:.:|:.....:|..|:..|:   .||..:.|
Mouse   190 ERGLACL-HHLQNLRRLDISDLPAVSHPGLTQILVEEMLPHCEVL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689
AMN1 <226..>334 CDD:187754
leucine-rich repeat 236..256 CDD:275381
leucine-rich repeat 263..288 CDD:275381
leucine-rich repeat 289..314 CDD:275381
leucine-rich repeat 315..347 CDD:275381
AMN1 347..524 CDD:187754 30/102 (29%)
leucine-rich repeat 348..373 CDD:275381
leucine-rich repeat 374..398 CDD:275381
leucine-rich repeat 399..424 CDD:275381
leucine-rich repeat 425..450 CDD:275381 7/24 (29%)
leucine-rich repeat 451..475 CDD:275381 8/24 (33%)
leucine-rich repeat 476..501 CDD:275381 9/24 (38%)
Dmac2NP_001277416.1 leucine-rich repeat 127..140 CDD:275381 4/13 (31%)
AMN1 149..>221 CDD:187754 22/72 (31%)
leucine-rich repeat 151..176 CDD:275381 8/24 (33%)
leucine-rich repeat 177..201 CDD:275381 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.