DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and fbxl8

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001032499.2 Gene:fbxl8 / 641481 ZFINID:ZDB-GENE-051120-81 Length:367 Species:Danio rerio


Alignment Length:265 Identity:66/265 - (24%)
Similarity:96/265 - (36%) Gaps:82/265 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 ELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRGIKKVQI 219
            |:|..||..||::|...|..||.||.:.....|.||..|.:.....|.|..::.|    :..|:.
Zfish     6 EILAHIFSFLPLQDKCNAFIVCKAWSNIMTHPSSWKDTEVRCESGTSVPDRYSDL----LPLVRN 66

  Fly   220 LSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQ 284
            |.||.||.|     ||                          |.||. |.:.:|......||   
Zfish    67 LKLRISLTD-----PA--------------------------NRKTA-LWVLQQAVAGGDGR--- 96

  Fly   285 HLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLE 349
                ||.|.:  || :.||.|......|:               ||:..:      ...|: .|.
Zfish    97 ----LEGLSI--CC-VANTPLFYAGQDLQ---------------QGLVDI------LTNGS-SLT 132

  Fly   350 YLGLQDCQ-RLSDEALGHIAQGLTSLKSI---NLSFCVSVTDSGLKHLARMPKLEQLNLRSCDNI 410
            ...|:... .|||..:..:|....:|||:   |.|....||...|:|:          |:||.::
Zfish   133 IFDLKGVPFTLSDSFVRSVAMLCPALKSLYINNQSLVCGVTSETLRHV----------LKSCPSL 187

  Fly   411 SDIGM 415
            :.:|:
Zfish   188 NVLGV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 13/34 (38%)
AMN1 <226..>334 CDD:187754 22/107 (21%)
leucine-rich repeat 236..256 CDD:275381 0/19 (0%)
leucine-rich repeat 263..288 CDD:275381 6/24 (25%)
leucine-rich repeat 289..314 CDD:275381 9/24 (38%)
leucine-rich repeat 315..347 CDD:275381 3/31 (10%)
AMN1 347..524 CDD:187754 19/73 (26%)
leucine-rich repeat 348..373 CDD:275381 6/25 (24%)
leucine-rich repeat 374..398 CDD:275381 9/26 (35%)
leucine-rich repeat 399..424 CDD:275381 4/17 (24%)
leucine-rich repeat 425..450 CDD:275381
leucine-rich repeat 451..475 CDD:275381
leucine-rich repeat 476..501 CDD:275381
fbxl8NP_001032499.2 F-box-like 2..41 CDD:289689 13/34 (38%)
leucine-rich repeat 131..157 CDD:275381 6/25 (24%)
leucine-rich repeat 158..186 CDD:275381 12/37 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.