DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Lgr4

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001285192.1 Gene:Lgr4 / 5740505 FlyBaseID:FBgn0085440 Length:809 Species:Drosophila melanogaster


Alignment Length:364 Identity:82/364 - (22%)
Similarity:142/364 - (39%) Gaps:109/364 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 VEAKL--HLKRSSP----------------SLFNCLVKRGIKKVQILSLRRSLKDLVLGVPA--L 236
            |:||.  ||.|..|                ..|:|..:..    :||...:.|.|:...:|.  |
  Fly   128 VDAKYWDHLYRKQPFGRHDNLRIGECLWPNENFSCPCRGD----EILCRFQQLTDIPERLPQHDL 188

  Fly   237 TSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLC--KQITDTSLGRIAQHLRNLETLELGGCCN 299
            .:|:|:|  |..: .:...|..:||::.:|.|..|  ::|...:..|:|.:  .|.||.:..   
  Fly   189 ATLDLTG--NNFE-TIHETFFSELPDVDSLVLKFCSIREIASHAFDRLADN--PLRTLYMDD--- 245

  Fly   300 ITNTGLLLIAWGLKKLKHL--------NLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDC 356
                         .||.||        |..|...::...:.||.           :.::|.||..
  Fly   246 -------------NKLPHLPEHFFPEGNQLSILILARNHLHHLK-----------RSDFLNLQKL 286

  Fly   357 QRLS--DEALGHI-AQGLTSLKSINLSFCVSVTDSGLKHL--ARMPK----LEQLNLRSCDNISD 412
            |.|.  ...:|:. |:....|.::.:.:   :.::.||.|  .|.|:    |..|:| :.:.|.|
  Fly   287 QELDLRGNRIGNFEAEVFARLPNLEVLY---LNENHLKRLDPDRFPRTLLNLHTLSL-AYNQIED 347

  Fly   413 IG--------MAYLTEGGSGINSL-DVSFCDKISDQALTHIAQGLYRLRSLSLNQCQITDHGMLK 468
            |.        :.||...|:.::.: |.:||:             |..|:.|.||:.:|....:  
  Fly   348 IAANTFPFPRLRYLFLAGNRLSHIRDETFCN-------------LSNLQGLHLNENRIEGFDL-- 397

  Fly   469 IAKALHELENLNIGQCSRITDKGLQTL-AEDLTNLKTID 506
              :|...|:||:   ...:|....||| :..|.||.::|
  Fly   398 --EAFACLKNLS---SLLLTGNRFQTLDSRVLKNLTSLD 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689
AMN1 <226..>334 CDD:187754 26/119 (22%)
leucine-rich repeat 236..256 CDD:275381 5/19 (26%)
leucine-rich repeat 263..288 CDD:275381 6/26 (23%)
leucine-rich repeat 289..314 CDD:275381 3/24 (13%)
leucine-rich repeat 315..347 CDD:275381 7/39 (18%)
AMN1 347..524 CDD:187754 43/179 (24%)
leucine-rich repeat 348..373 CDD:275381 7/27 (26%)
leucine-rich repeat 374..398 CDD:275381 5/25 (20%)
leucine-rich repeat 399..424 CDD:275381 9/32 (28%)
leucine-rich repeat 425..450 CDD:275381 4/25 (16%)
leucine-rich repeat 451..475 CDD:275381 6/23 (26%)
leucine-rich repeat 476..501 CDD:275381 8/25 (32%)
Lgr4NP_001285192.1 Ldl_recept_a 87..124 CDD:278486
LRR_RI <184..397 CDD:238064 57/261 (22%)
LRR_8 188..248 CDD:290566 17/80 (21%)
leucine-rich repeat 188..211 CDD:275380 7/25 (28%)
leucine-rich repeat 212..235 CDD:275380 5/22 (23%)
leucine-rich repeat 238..261 CDD:275380 7/38 (18%)
LRR_8 261..320 CDD:290566 11/72 (15%)
leucine-rich repeat 262..285 CDD:275380 5/33 (15%)
LRR_4 284..325 CDD:289563 9/43 (21%)
leucine-rich repeat 286..309 CDD:275380 5/22 (23%)
LRR_4 308..348 CDD:289563 9/43 (21%)
leucine-rich repeat 310..334 CDD:275380 5/26 (19%)
leucine-rich repeat 335..357 CDD:275380 6/22 (27%)
LRR_8 356..416 CDD:290566 17/79 (22%)
leucine-rich repeat 358..381 CDD:275380 7/35 (20%)
LRR_4 381..421 CDD:289563 13/46 (28%)
leucine-rich repeat 382..405 CDD:275380 7/26 (27%)
leucine-rich repeat 406..427 CDD:275380 6/23 (26%)
7tm_1 483..741 CDD:278431
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.