DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and fbxl3l

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_693270.2 Gene:fbxl3l / 564855 ZFINID:ZDB-GENE-130530-598 Length:448 Species:Danio rerio


Alignment Length:363 Identity:80/363 - (22%)
Similarity:133/363 - (36%) Gaps:117/363 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 NLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKL------HLKRSSPSLFNCL 209
            ||...::..||::|.:.|..||:.||..|.:..:...:|:..|.:|      :|:.:.|.|...:
Zfish    58 NLPHHVVLHIFQYLSLVDRARASSVCRRWNEVFHIPDLWRRFEFELNQPATSYLRSTHPDLIQQI 122

  Fly   210 VKRGIKKVQILSLR---------------RSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVD 259
            :||..:.:|.:|.:               ..|.:..:....|.|.......:|:..:...|.:|.
Zfish   123 IKRHAQHLQYVSFKVDSCTESAEAACNILSQLVNCTIKTLGLISTARPSFMDVSQSHFVSALTVV 187

  Fly   260 LPNLKTLDLSLCKQITDTSLG------RIAQHLRNLETLELGGCCNITNTGLLLIA---WGLKKL 315
            ..|.|:|. |:  :|.||.:.      .:|.:...|:.|::..|.:::..|:|.:|   .||::|
Zfish   188 FVNSKSLS-SI--KIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLREL 249

  Fly   316 ------------------KHLNL---------------------RSCWHISDQGIGHLAG----- 336
                              ||::|                     :|.|   |..|.|...     
Zfish   250 ALNYHLLSDELLLALSSEKHVHLEHLRIDVVSENPGQTQFHTIKKSSW---DALIRHSPQVNIVM 311

  Fly   337 ------------FSRETAEGNL---------QLEYLGLQDCQRL------------SDEALGHIA 368
                        |..||...:|         .|..:|| :|.||            .||.|..||
Zfish   312 YFFLYEEEFEPFFREETPVTHLYFGRAVSKDMLGRIGL-NCPRLVELVVCANGLEPLDEELIRIA 375

  Fly   369 QGLTSLKSINLSFCVSVTDSGLKHLARM--PKLEQLNL 404
            ....||.:|.|..| .||.||.....:|  .:|.||::
Zfish   376 DRCKSLTAIGLGEC-EVTCSGFMEFVKMCGGRLSQLSI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 11/38 (29%)
AMN1 <226..>334 CDD:187754 30/155 (19%)
leucine-rich repeat 236..256 CDD:275381 3/19 (16%)
leucine-rich repeat 263..288 CDD:275381 7/30 (23%)
leucine-rich repeat 289..314 CDD:275381 8/27 (30%)
leucine-rich repeat 315..347 CDD:275381 13/96 (14%)
AMN1 347..524 CDD:187754 24/72 (33%)
leucine-rich repeat 348..373 CDD:275381 11/36 (31%)
leucine-rich repeat 374..398 CDD:275381 9/25 (36%)
leucine-rich repeat 399..424 CDD:275381 3/6 (50%)
leucine-rich repeat 425..450 CDD:275381
leucine-rich repeat 451..475 CDD:275381
leucine-rich repeat 476..501 CDD:275381
fbxl3lXP_693270.2 F-box-like 56..99 CDD:289689 12/40 (30%)
leucine-rich repeat 194..218 CDD:275381 6/26 (23%)
leucine-rich repeat 220..245 CDD:275381 6/24 (25%)
leucine-rich repeat 246..271 CDD:275381 4/24 (17%)
leucine-rich repeat 272..306 CDD:275381 6/36 (17%)
leucine-rich repeat 307..353 CDD:275381 8/46 (17%)
AMN1 <347..>412 CDD:187754 23/66 (35%)
leucine-rich repeat 354..380 CDD:275381 6/25 (24%)
leucine-rich repeat 381..403 CDD:275381 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.