DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and FBXL12

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_016882401.1 Gene:FBXL12 / 54850 HGNCID:13611 Length:343 Species:Homo sapiens


Alignment Length:299 Identity:67/299 - (22%)
Similarity:113/299 - (37%) Gaps:87/299 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 TSLGRIAQHLRNLETLELGGCCNITN------TGL-----LLIAWGLKKLKHLNLRS--CWHISD 328
            ::|..:..|.     .|:|..|...:      .||     ||:..|.....||.:|.  .||:..
Human    22 SALNLVKPHF-----FEIGSACRRDHGDFGRTAGLGPARDLLLPPGTGPDPHLQMRPKVMWHLLR 81

  Fly   329 QGIGHLAGFSRETAEGNLQLEYL--GLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLK 391
            :   ::|........|.    ||  |.| ..:||...|..:.|...:||.:    |:.|.|..:.
Human    82 R---YMASRLHSLRMGG----YLFSGSQ-APQLSPALLRALGQKCPNLKRL----CLHVADLSMV 134

  Fly   392 HLARMPK-LEQLNLRSCDNISDIGMAYL--TEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRS 453
            .:..:|. |..|.|.||    :|.||:|  .:..:.:..|:....|::......|: |||.|.|:
Human   135 PITSLPSTLRTLELHSC----EISMAWLHKQQDPTVLPLLECIVLDRVPAFRDEHL-QGLTRFRA 194

  Fly   454 LSLNQCQITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCT------- 511
                                  |.:|.:|...|:|:.||....::|:.|:.:::.|||       
Human   195 ----------------------LRSLVLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTL 237

  Fly   512 ------------------QLSSKGIDIIMKLPKLQKLNL 532
                              .||:.|:.::..:|.|:.|.|
Human   238 LAISRHLRDVRKIRLTVRGLSAPGLAVLEGMPALESLCL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689
AMN1 <226..>334 CDD:187754 15/69 (22%)
leucine-rich repeat 236..256 CDD:275381
leucine-rich repeat 263..288 CDD:275381 2/10 (20%)
leucine-rich repeat 289..314 CDD:275381 8/35 (23%)
leucine-rich repeat 315..347 CDD:275381 7/33 (21%)
AMN1 347..524 CDD:187754 46/206 (22%)
leucine-rich repeat 348..373 CDD:275381 8/26 (31%)
leucine-rich repeat 374..398 CDD:275381 5/23 (22%)
leucine-rich repeat 399..424 CDD:275381 9/26 (35%)
leucine-rich repeat 425..450 CDD:275381 6/24 (25%)
leucine-rich repeat 451..475 CDD:275381 1/23 (4%)
leucine-rich repeat 476..501 CDD:275381 8/24 (33%)
FBXL12XP_016882401.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.