DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and FBXL19

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001093254.2 Gene:FBXL19 / 54620 HGNCID:25300 Length:694 Species:Homo sapiens


Alignment Length:339 Identity:85/339 - (25%)
Similarity:129/339 - (38%) Gaps:94/339 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PHRPASPESPPPVEGTHISNLFPELLE--------------------QIFEHLPVRDLGRAAQVC 176
            |..||.|..||.:| .|:....|...|                    ::|:||..|:|....:||
Human   385 PLGPAPPPRPPQLE-RHVVRPPPRSPEPDTLPLAAGSDHPLPRAAWLRVFQHLGPRELCICMRVC 448

  Fly   177 TAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKR----------GIKKVQILSLRRSLKDLVL 231
            ..|....|.|.:|..::.. ..|..:|.:.:.:|:|          |:.|.|::.|...|:    
Human   449 RTWSRWCYDKRLWPRMDLS-RRKSLTPPMLSGVVRRQPRALDLSWTGVSKKQLMWLLNRLQ---- 508

  Fly   232 GVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITDTSL----------------- 279
               .|..|.||||..::...||   |..||.|:.|||...:.:.|:.|                 
Human   509 ---GLQELVLSGCSWLSVSALG---SAPLPALRLLDLRWIEDVKDSQLRELLLPPPDTKPGQTES 567

  Fly   280 -GRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAE 343
             ||    |:.:..|.|.| ..:|:..|.|:.....:|..|:|..|.|:.|..: ||  .:..|:.
Human   568 RGR----LQGVAELRLAG-LELTDASLRLLLRHAPQLSALDLSHCAHVGDPSV-HL--LTAPTSP 624

  Fly   344 GNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHLARMPKLEQLNLRSCD 408
            ....|.:|.|..|.||:|.                   |:.:       ..|.|:|.:|:||||.
Human   625 LRETLVHLNLAGCHRLTDH-------------------CLPL-------FRRCPRLRRLDLRSCR 663

  Fly   409 NISDIGMAYLTEGG 422
            .:|....|.|...|
Human   664 QLSPEACARLAAAG 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 12/60 (20%)
AMN1 <226..>334 CDD:187754 33/125 (26%)
leucine-rich repeat 236..256 CDD:275381 8/19 (42%)
leucine-rich repeat 263..288 CDD:275381 9/42 (21%)
leucine-rich repeat 289..314 CDD:275381 6/24 (25%)
leucine-rich repeat 315..347 CDD:275381 9/31 (29%)
AMN1 347..524 CDD:187754 20/76 (26%)
leucine-rich repeat 348..373 CDD:275381 7/24 (29%)
leucine-rich repeat 374..398 CDD:275381 2/23 (9%)
leucine-rich repeat 399..424 CDD:275381 10/24 (42%)
leucine-rich repeat 425..450 CDD:275381
leucine-rich repeat 451..475 CDD:275381
leucine-rich repeat 476..501 CDD:275381
FBXL19NP_001093254.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
zf-CXXC <50..77 CDD:251032
PHD_FXL19 87..148 CDD:277115
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..420 10/35 (29%)
F-box-like 424..465 CDD:315592 11/40 (28%)
leucine-rich repeat 461..485 CDD:275381 5/24 (21%)
AMN1 466..665 CDD:332986 60/243 (25%)
leucine-rich repeat 486..508 CDD:275381 4/21 (19%)
LRR 1 492..517 8/31 (26%)
leucine-rich repeat 510..533 CDD:275381 10/25 (40%)
LRR 2 518..541 10/25 (40%)
leucine-rich repeat 534..573 CDD:275381 9/42 (21%)
leucine-rich repeat 574..598 CDD:275381 6/24 (25%)
LRR 3 581..606 7/25 (28%)
leucine-rich repeat 599..623 CDD:275381 8/26 (31%)
LRR 4 607..636 9/31 (29%)
leucine-rich repeat 629..653 CDD:275381 9/49 (18%)
LRR 5 637..661 10/49 (20%)
leucine-rich repeat 654..686 CDD:275381 10/24 (42%)
LRR 6 662..694 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.