DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Fbxl3

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001347270.1 Gene:Fbxl3 / 50789 MGIID:1354702 Length:428 Species:Mus musculus


Alignment Length:403 Identity:90/403 - (22%)
Similarity:159/403 - (39%) Gaps:105/403 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PHRP-ASPESPPPVEGTHISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAK 195
            |.|| .:.|...|.:.   .||..:::..:|::||:.|...|:|||..|....:...:|:..|.:
Mouse    21 PKRPRTTQERSQPCDW---GNLLQDIVLHVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFE 82

  Fly   196 L------HLKRSSPSLFNCLVKRGIKKVQILSLR-RSLKDL------VLGVPALTSLNLSGCFNV 247
            |      :||.:.|.|...::||....:|.:|.: .|.|:.      :|......||...|..:.
Mouse    83 LNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLKTLGLIST 147

  Fly   248 A-----DMNLGH---AFSVDLPNLKTLDLSLCKQITDTSLG------RIAQHLRNLETLELGGCC 298
            |     |:...|   |.:|...|.|:|. ||  :|.||.:.      .:|.:...|:.|::..|.
Mouse   148 ARPSFMDLPKSHFISALTVVFVNSKSLS-SL--KIDDTPVDDPSLKVLVANNSDTLKLLKMSSCP 209

  Fly   299 NITNTGLLLIAWGLKKLKHLNLRSCWH-ISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDE 362
            :::..|:|.:|.....|:.|.|.  :| :||:.:..|      ::|.:::||:|.:........:
Mouse   210 HVSPAGILCVADQCHGLRELALN--YHLLSDELLLAL------SSEKHVRLEHLRIDVVSENPGQ 266

  Fly   363 ALGHIAQGLTSLKSINLSFCVSVTDSGLKHLARMPKLEQLNL----------------------- 404
            ...|..|             .|..|:.:||   .||   :||                       
Mouse   267 THFHTIQ-------------KSSWDAFIKH---SPK---VNLVMYFFLYEEEFDPFFRYEIPATH 312

  Fly   405 ----RSC--DNISDIGM-----AYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQ 458
                ||.  |.:..:||     ..|....:|:..|         |:.|..||:....|.::.|.:
Mouse   313 LYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPL---------DEELIRIAERCKNLSAIGLGE 368

  Fly   459 CQITDHGMLKIAK 471
            |:::....::..|
Mouse   369 CEVSCSAFVEFVK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 11/40 (28%)
AMN1 <226..>334 CDD:187754 31/128 (24%)
leucine-rich repeat 236..256 CDD:275381 6/27 (22%)
leucine-rich repeat 263..288 CDD:275381 8/30 (27%)
leucine-rich repeat 289..314 CDD:275381 6/24 (25%)
leucine-rich repeat 315..347 CDD:275381 8/32 (25%)
AMN1 347..524 CDD:187754 29/159 (18%)
leucine-rich repeat 348..373 CDD:275381 5/24 (21%)
leucine-rich repeat 374..398 CDD:275381 4/23 (17%)
leucine-rich repeat 399..424 CDD:275381 8/58 (14%)
leucine-rich repeat 425..450 CDD:275381 5/24 (21%)
leucine-rich repeat 451..475 CDD:275381 4/21 (19%)
leucine-rich repeat 476..501 CDD:275381
Fbxl3NP_001347270.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 4/11 (36%)
F-box-like 36..77 CDD:315592 11/43 (26%)
LRR 1 119..146 6/26 (23%)
leucine-rich repeat 174..199 CDD:275381 7/27 (26%)
LRR 2 181..207 5/25 (20%)
leucine-rich repeat 200..225 CDD:275381 6/24 (25%)
LRR 3 208..233 7/26 (27%)
LRR 4 234..259 8/30 (27%)
leucine-rich repeat 252..286 CDD:275381 9/49 (18%)
leucine-rich repeat 287..333 CDD:275381 7/45 (16%)
LRR 5 316..341 6/24 (25%)
leucine-rich repeat 334..360 CDD:275381 7/34 (21%)
LRR 6 343..368 8/33 (24%)
leucine-rich repeat 361..383 CDD:275381 4/21 (19%)
LRR 7 369..394 2/13 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.