DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Lrrc29

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_006255593.1 Gene:Lrrc29 / 502201 RGDID:1593150 Length:673 Species:Rattus norvegicus


Alignment Length:566 Identity:119/566 - (21%)
Similarity:199/566 - (35%) Gaps:199/566 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRGIKKVQ 218
            |::|..|...||:.|...|:.|..||..||........|...:.:..:|.|....|.:|||..:.
  Rat    59 PQMLTYILSFLPLSDQKEASLVSRAWYYAAQNALRETNVRYNIPVSSASLSAIKSLGRRGISCIS 123

  Fly   219 ILSL--------------------------------RRSLKDLVLGVPALTSLNLSGC------- 244
            :.:|                                ..|...|:||.|.|.:|:||||       
  Rat   124 LTNLDGSPASHQVLQSVAYHLGPHLQSLCLGGGSPTEASFLALILGCPVLRTLDLSGCNSLFTSG 188

  Fly   245 ---------------------FNVA------DMNLGHAFS------------------------- 257
                                 .|:|      |::..|..|                         
  Rat   189 TLLAQPETAQCVRKALSGLRDLNLAGLRDLTDLSFNHLSSCFPSLERLSLAYCHLTFELGSTWGS 253

  Fly   258 ----------------------------------VDLP-------------NLKTLDLSLCKQIT 275
                                              ..||             .|:.|:|:.||.::
  Rat   254 TSPQASSPSQLSFHNLLQFIKERAGTLRALDLSGTGLPPEALQALGQVTGLKLEELNLNSCKDLS 318

  Fly   276 DTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGF--- 337
            ..::..:.:....|.:|:|.||..:|:..||.::.||..|:||:|:....::|.|...|...   
  Rat   319 SEAVATLCRQQPGLTSLDLSGCSELTDRALLAVSRGLHHLRHLSLKKLQRLTDAGCIALGALHEL 383

  Fly   338 ------------SRETAE--GNLQ-----LEYLGLQDCQRLSDEALGHIAQGL-TSLKSINLSFC 382
                        .||.|:  |:::     |..|.|..|..|.|.::..:...| .|||.::||.|
  Rat   384 QSLDMAECCLVSGRELAQVLGSVRRAPPALTSLRLAYCSSLKDASVLSMIPALGPSLKVLDLSSC 448

  Fly   383 VSVTDSGLKHLAR-MPKLEQLNLRSCDNISDIGMAYLTE-------------------------- 420
            |::|:..::.:.. :..|..|.|..|..:.|.|:..|.|                          
  Rat   449 VALTNQTMQAICTYLIHLSVLRLAWCKELQDWGLLGLKEPSDEPVLNPQLHQEVENQAPDHQEPS 513

  Fly   421 ----GGS-----GINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQC-QITDHGMLKIAKALHE 475
                |.|     .:..||::.|.|::|.:|..:.| ..:||.|||:.. ..||.|::.:|:....
  Rat   514 SEPQGSSLLMLQALQELDLTACSKLTDASLAKVLQ-FPQLRQLSLSLLPAFTDMGLVAVARGCPS 577

  Fly   476 LENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSKGIDII 521
            ||.|.:..||.::|:|....|.....|:.::|..|:|::.:.:|.|
  Rat   578 LERLTLSHCSHLSDEGWVQAARLWPRLQHLNLSSCSQVTEQTLDTI 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 12/35 (34%)
AMN1 <226..>334 CDD:187754 38/213 (18%)
leucine-rich repeat 236..256 CDD:275381 10/53 (19%)
leucine-rich repeat 263..288 CDD:275381 5/24 (21%)
leucine-rich repeat 289..314 CDD:275381 10/24 (42%)
leucine-rich repeat 315..347 CDD:275381 11/48 (23%)
AMN1 347..524 CDD:187754 55/218 (25%)
leucine-rich repeat 348..373 CDD:275381 7/25 (28%)
leucine-rich repeat 374..398 CDD:275381 7/24 (29%)
leucine-rich repeat 399..424 CDD:275381 10/59 (17%)
leucine-rich repeat 425..450 CDD:275381 7/24 (29%)
leucine-rich repeat 451..475 CDD:275381 9/24 (38%)
leucine-rich repeat 476..501 CDD:275381 8/24 (33%)
Lrrc29XP_006255593.1 leucine-rich repeat 124..142 CDD:275381 1/17 (6%)
LRR_RI <170..410 CDD:238064 40/239 (17%)
leucine-rich repeat 173..206 CDD:275381 6/32 (19%)
leucine-rich repeat 207..232 CDD:275381 5/24 (21%)
leucine-rich repeat 233..279 CDD:275381 0/45 (0%)
leucine-rich repeat 280..300 CDD:275381 2/19 (11%)
AMN1 292..480 CDD:187754 45/187 (24%)
leucine-rich repeat 306..331 CDD:275381 5/24 (21%)
leucine-rich repeat 332..357 CDD:275381 10/24 (42%)
leucine-rich repeat 358..439 CDD:275381 18/80 (23%)
leucine-rich repeat 383..408 CDD:275381 4/24 (17%)
leucine-rich repeat 413..437 CDD:275381 6/23 (26%)
leucine-rich repeat 440..465 CDD:275381 7/24 (29%)
leucine-rich repeat 466..526 CDD:275381 10/59 (17%)
leucine-rich repeat 527..577 CDD:275381 16/50 (32%)
AMN1 <564..>638 CDD:187754 18/60 (30%)
leucine-rich repeat 578..603 CDD:275381 8/24 (33%)
leucine-rich repeat 604..629 CDD:275381 6/20 (30%)
leucine-rich repeat 630..655 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.