DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ppa and AT4G03635

DIOPT Version :9

Sequence 1:	NP_001261138.1	Gene:	Ppa / 37602	FlyBaseID:	FBgn0020257	Length:	562	Species:	Drosophila melanogaster
Sequence 2:	NP_001078350.1	Gene:	AT4G03635 / 5008119	AraportID:	AT4G03635	Length:	88	Species:	Arabidopsis thaliana

Alignment Length:	96	Identity:	28/96 - (29%)
Similarity:	35/96 - (36%)	Gaps:	26/96 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   437 SDQALTHIAQGLYRLRSLSLNQC-QITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLT 500
            :|...::|||....||.|.|..| .:|.:|.:.....|..||.|:|.|
plant     6 NDSLYSYIAQRSSNLRCLRLAMCYPLTGNGFVSAVMKLSFLEELDISQ----------------- 53

  Fly   501 NLKTIDLYGCTQLSSKGIDIIMKLPKLQKLN 531
                    |.|||..|.|.....|.|..|||
plant    54 --------GYTQLDLKAIGHSCPLLKTFKLN 76

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ppa	NP_001261138.1	F-box-like	149..190	CDD:289689
		AMN1	<226..>334	CDD:187754
		leucine-rich repeat	236..256	CDD:275381
		leucine-rich repeat	263..288	CDD:275381
		leucine-rich repeat	289..314	CDD:275381
		leucine-rich repeat	315..347	CDD:275381
		AMN1	347..524	CDD:187754	23/87 (26%)
		leucine-rich repeat	348..373	CDD:275381
		leucine-rich repeat	374..398	CDD:275381
		leucine-rich repeat	399..424	CDD:275381
		leucine-rich repeat	425..450	CDD:275381	4/12 (33%)
		leucine-rich repeat	451..475	CDD:275381	8/24 (33%)
		leucine-rich repeat	476..501	CDD:275381	5/24 (21%)
AT4G03635	NP_001078350.1	leucine-rich repeat	20..45	CDD:275381	8/24 (33%)
AT4G03635	NP_001078350.1	leucine-rich repeat	46..69	CDD:275381	11/47 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1947
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810