DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Fbxl8

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001102598.1 Gene:Fbxl8 / 498941 RGDID:1566420 Length:374 Species:Rattus norvegicus


Alignment Length:394 Identity:99/394 - (25%)
Similarity:138/394 - (35%) Gaps:118/394 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 ISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSS---PSLFNCLV 210
            |..|..|:|..||..||:||...||:||.||..||...:||.........:..:   |.|..|| 
  Rat     5 IEKLPEEVLGLIFRDLPLRDRAVAARVCRAWAAAATNSAVWYDTSISCDCELENLLPPGLSACL- 68

  Fly   211 KRGIKKVQILSL---------RRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTL 266
                ..:..|||         ||:..:|      ||:|                 :...|.|:.|
  Rat    69 ----DHIHNLSLEYEPSKKPSRRTATEL------LTAL-----------------ASRAPRLRGL 106

  Fly   267 DLSLC---KQITDTS---LGRI------AQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHL- 318
            .|. |   |.:.|..   ||.:      |..||:|:...|.  ..:.:|.:|.:|.|..:|:.| 
  Rat   107 RLE-CRGEKPLFDAGRDILGALHTVCGAAHQLRHLDLRHLP--YTVDDTLVLKVAGGCPELRSLF 168

  Fly   319 -----------------NLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGH 366
                             .|.:|.|:...|: |||..||..      ||.|           |..|
  Rat   169 LDNHALVNSVQPASVLRLLEACPHLRALGL-HLASMSRAA------LELL-----------AAPH 215

  Fly   367 IAQ-GLTSLKSINLSFCVSVTDSGLKHLARMPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDV 430
            .|. .|.:||      |....|      ||...|           .|...|.||....|: .:::
  Rat   216 RAPFTLLALK------CACPED------ARASPL-----------PDEAWATLTCYHPGL-KVEL 256

  Fly   431 SFCDKISDQALTHIAQGLYRLRSLSLNQCQITDHGMLKIAKALHELENLNIGQCSRITDKGLQTL 495
            .....:.|:|::.|.|....:..|.||....| .|.::.| |.|..|.|...:........|.|.
  Rat   257 ELEPVLPDEAVSRILQPAVPVAVLRLNLSGDT-VGPVRFA-ARHYAETLRALEVRASASTELHTA 319

  Fly   496 AEDL 499
            .|:|
  Rat   320 LEEL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 19/40 (48%)
AMN1 <226..>334 CDD:187754 28/137 (20%)
leucine-rich repeat 236..256 CDD:275381 3/19 (16%)
leucine-rich repeat 263..288 CDD:275381 10/36 (28%)
leucine-rich repeat 289..314 CDD:275381 6/24 (25%)
leucine-rich repeat 315..347 CDD:275381 11/49 (22%)
AMN1 347..524 CDD:187754 37/154 (24%)
leucine-rich repeat 348..373 CDD:275381 7/25 (28%)
leucine-rich repeat 374..398 CDD:275381 6/23 (26%)
leucine-rich repeat 399..424 CDD:275381 5/24 (21%)
leucine-rich repeat 425..450 CDD:275381 4/24 (17%)
leucine-rich repeat 451..475 CDD:275381 7/23 (30%)
leucine-rich repeat 476..501 CDD:275381 6/24 (25%)
Fbxl8NP_001102598.1 F-box-like 5..>34 CDD:403981 14/28 (50%)
leucine-rich repeat 103..136 CDD:275381 9/33 (27%)
leucine-rich repeat 137..163 CDD:275381 8/27 (30%)
leucine-rich repeat 164..192 CDD:275381 4/27 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.