DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and fbxl5

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_012816107.1 Gene:fbxl5 / 496483 XenbaseID:XB-GENE-968565 Length:662 Species:Xenopus tropicalis


Alignment Length:474 Identity:113/474 - (23%)
Similarity:167/474 - (35%) Gaps:149/474 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 ISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKL------------HLK-- 199
            |.||.||::..||.:|..:||.|.:||.|.|...|...|:|:.:...|            ||.  
 Frog   205 ICNLPPEVMLNIFSYLNPQDLCRCSQVNTKWAQLARTGSLWRHLYPVLWARGDWYSGPPTHLDNE 269

  Fly   200 --------------------------------RSSPS---------LFNCLVKRGIKKVQILS-L 222
                                            ...||         |.|.||.      .||. :
 Frog   270 PDEDWISRRKDESRAYQEWDEDADIDESEETGEDDPSISVAQREKELLNSLVH------YILPYI 328

  Fly   223 RRSLKDLVLGVPALTSLN-----LSGCFNVADMNL-----------GHAFSVDLPNLKTLDLSLC 271
            ..|:|.|||...:.||..     |..|.|:..::|           |..|.. ...|:.:|||.|
 Frog   329 GHSVKTLVLAYSSATSNKVIRQILEYCPNMEHLDLTQTDISDSAFNGWCFGA-CQTLRHIDLSGC 392

  Fly   272 KQITDTSLGRIAQHL--------------RNLET-------LELGGCCNITNTGLLLIAWGLKKL 315
            ::|||::|.:::..|              ||..|       :..|....||....:...:...::
 Frog   393 EKITDSALEKLSVALGMPLAHKKRLLKCYRNNRTVKDIRNQMRCGSLAQITGESGIYSDYSSSQI 457

  Fly   316 KHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTS------- 373
            ..||..:...|.|     .|.:...|.:|...||......|  .|:........|..:       
 Frog   458 WILNSGNLGDIED-----AADWKFRTTDGLGVLEMTPNLTC--FSNGCCSRAVPGRWTNVIRQEH 515

  Fly   374 LKSINLSFC-VSVTDSGLKHLARMP--KLEQLNLRSCDNISDI--GMAYLTEGGSGINSLDVSFC 433
            .|:..|::| .::..:.|:.:..:|  .:....|:|  .|.||  |.|.|               
 Frog   516 CKAAPLNYCGHTLCGNTLRTIQALPGSNIGTKTLQS--EIRDICPGSAKL--------------- 563

  Fly   434 DKISDQALTHIAQGLYRLRSLSLNQC-QITDHGM--LKIAKALHELENLNIGQCSRITDKGLQTL 495
                ||.:..:      |:.|||:.| ||||||:  |.|...|..||:||:..|..:|..|||.|
 Frog   564 ----DQQVARV------LQFLSLSGCHQITDHGLRVLTIGGGLPNLEHLNLSGCLNVTGSGLQDL 618

  Fly   496 AEDLTNLKTIDLYGCTQLS 514
            .....:|.....|.|..:|
 Frog   619 VSACPSLNDEHFYYCDNIS 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 17/40 (43%)
AMN1 <226..>334 CDD:187754 32/144 (22%)
leucine-rich repeat 236..256 CDD:275381 7/35 (20%)
leucine-rich repeat 263..288 CDD:275381 10/38 (26%)
leucine-rich repeat 289..314 CDD:275381 4/31 (13%)
leucine-rich repeat 315..347 CDD:275381 7/31 (23%)
AMN1 347..524 CDD:187754 48/183 (26%)
leucine-rich repeat 348..373 CDD:275381 5/24 (21%)
leucine-rich repeat 374..398 CDD:275381 5/26 (19%)
leucine-rich repeat 399..424 CDD:275381 8/26 (31%)
leucine-rich repeat 425..450 CDD:275381 2/24 (8%)
leucine-rich repeat 451..475 CDD:275381 14/26 (54%)
leucine-rich repeat 476..501 CDD:275381 10/24 (42%)
fbxl5XP_012816107.1 Hr_FBXL5 7..160 CDD:213984
F-box-like 205..249 CDD:372399 18/43 (42%)
leucine-rich repeat 332..357 CDD:275381 8/24 (33%)
AMN1 <340..444 CDD:187754 23/104 (22%)
leucine-rich repeat 358..383 CDD:275381 3/25 (12%)
leucine-rich repeat 384..438 CDD:275381 13/53 (25%)
leucine-rich repeat 439..500 CDD:275381 13/67 (19%)
leucine-rich repeat 511..559 CDD:275381 10/49 (20%)
AMN1 556..>625 CDD:187754 30/93 (32%)
leucine-rich repeat 571..598 CDD:275381 14/26 (54%)
leucine-rich repeat 599..624 CDD:275381 10/24 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.