DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and gadr-5

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001252264.2 Gene:gadr-5 / 4927064 WormBaseID:WBGene00045058 Length:915 Species:Caenorhabditis elegans


Alignment Length:483 Identity:100/483 - (20%)
Similarity:175/483 - (36%) Gaps:146/483 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 ALYLQHAAAAAAAAAAAAAHAQHHHHHHHHLPHRPASPESPPPVEGTHISNLFPEL----LEQIF 161
            |..|.|....:.|..|||..|:|....|:..|                  |:|.||    .|.||
 Worm   217 AYRLPHKLTNSLANIAAAQIARHIEDGHYKDP------------------NIFQELDTKSHEAIF 263

  Fly   162 EHL------PVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRS---SPSLFNCLVKRGIKKV 217
            ..|      ..:.:.:|.|:       ..:..:.|.|.|:.:..|:   ..||.:.|..:.:.|:
 Worm   264 SKLLLLNPKAYKFIAKATQI-------QESVVIGKRVHAQHYYARNIDIMTSLTSVLYGKSLAKI 321

  Fly   218 QILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSLCKQITDTSLGRI 282
            ..|.:......|..|...|          :..|         ||:|::||:| .|.::.....::
 Worm   322 HSLDIGECRSQLTPGWVRL----------IGTM---------LPSLQSLDIS-NKPLSKEDFSQL 366

  Fly   283 AQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQ------GIGHLAGF---- 337
            ....:||:.|      ||::|.:..:. |:.|||:|.:.|..::..:      .:..|.|.    
 Worm   367 CNFFQNLQKL------NISDTCVKKLQ-GISKLKNLKVLSMRNLQFRTATDMLDLFKLKGLVALD 424

  Fly   338 -SRETAEGNLQ-----------------LEYLGLQDCQRLSDEA-----LGHIAQGLTSLKSIN- 378
             ||:.|:.|::                 |:..|....|.|.|..     |..|....|.|:..| 
 Worm   425 VSRDIAKANIKTIRQFVECGNVLPSLTFLDASGTDINQDLLDSLEYQPNLQKILAIDTDLQDSNT 489

  Fly   379 ---LSFCVSVTDSGLKHLARMPKLE-QLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQ 439
               |:|  :..::.||.||....|: ....|.|  ::.|...:......| ...||..|.|...:
 Worm   490 PKVLNF--ATLETTLKALAHYTNLKNSAATRRC--LASIKSQFKKNHDDG-ERYDVVNCLKHVIE 549

  Fly   440 AL------------------THIAQGLYRLRSLSLNQCQITDHGMLKIAKALHELENLNIGQCSR 486
            |:                  |:| ||:..|..:|:|:..:           .|:::       ::
 Worm   550 AIETFSPDGSLDVNTMWSGHTYI-QGVMCLTEISINKSHL-----------FHQID-------AK 595

  Fly   487 ITDKGLQTLAEDLTNLK-TIDLYGCTQL 513
            :..:.|...:|.||.|| ::..:.|.::
 Worm   596 LVLEMLLVASERLTILKSSLSQHPCQEV 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 10/50 (20%)
AMN1 <226..>334 CDD:187754 23/113 (20%)
leucine-rich repeat 236..256 CDD:275381 2/19 (11%)
leucine-rich repeat 263..288 CDD:275381 5/24 (21%)
leucine-rich repeat 289..314 CDD:275381 6/24 (25%)
leucine-rich repeat 315..347 CDD:275381 10/42 (24%)
AMN1 347..524 CDD:187754 41/213 (19%)
leucine-rich repeat 348..373 CDD:275381 7/29 (24%)
leucine-rich repeat 374..398 CDD:275381 8/27 (30%)
leucine-rich repeat 399..424 CDD:275381 4/25 (16%)
leucine-rich repeat 425..450 CDD:275381 9/42 (21%)
leucine-rich repeat 451..475 CDD:275381 3/23 (13%)
leucine-rich repeat 476..501 CDD:275381 3/24 (13%)
gadr-5NP_001252264.2 MFS <15..201 CDD:119392
LRR <311..514 CDD:227223 49/231 (21%)
leucine-rich repeat 348..372 CDD:275382 5/24 (21%)
LRR_4 371..>402 CDD:289563 12/37 (32%)
leucine-rich repeat 373..396 CDD:275382 9/29 (31%)
leucine-rich repeat 397..419 CDD:275380 2/21 (10%)
leucine-rich repeat 420..449 CDD:275380 4/28 (14%)
leucine-rich repeat 450..473 CDD:275380 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162685
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.