DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and fbxl4

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001007316.1 Gene:fbxl4 / 492349 ZFINID:ZDB-GENE-041114-187 Length:607 Species:Danio rerio


Alignment Length:399 Identity:104/399 - (26%)
Similarity:157/399 - (39%) Gaps:92/399 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 ELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNCLVKRGIKKVQI 219
            ||::.|..||||.||.|.||.|                  ||..|.....|         :.:| 
Zfish   272 ELIQLIVSHLPVPDLCRLAQSC------------------KLFHKHCCDPL---------QYIQ- 308

  Fly   220 LSLR--------RSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSL-CKQIT 275
            |||:        .||..|......|..||||...|...:......|.    :|....|| |.:::
Zfish   309 LSLQPYWARLTDASLCHLQSRCTLLQRLNLSWTGNRGAVTPAGFCSF----MKACGASLVCLEVS 369

  Fly   276 DTSLGRIAQHLRNLETLELGGCCN-ITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSR 339
                                 ||: :|...|.:|......|:.|||.||..:..|...|:|..: 
Zfish   370 ---------------------CCHFLTEACLEVITQTCPCLQELNLASCDRLQPQAFNHIAKLT- 412

  Fly   340 ETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTD-----SGLKHLARMPKL 399
                   .|..|.|.. .::...|:..|......|:.:||..||.:.|     |.|.  ||...|
Zfish   413 -------HLRRLVLYR-TKVEQSAILSILTFCPELRHLNLGSCVMIEDYDVVVSMLS--ARCRSL 467

  Fly   400 EQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKI--SDQALTHIAQGLYRLRSLSLNQCQ-I 461
            ..|:|..|.|:|:.|:|.|..|...:..||:.:|..:  |.....|:|:.|.|||.|.|...: :
Zfish   468 RSLDLWRCRNLSERGLAELVSGCRLLEELDLGWCSTLQSSSACFQHLARSLPRLRKLFLTANRTV 532

  Fly   462 TDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSKGIDIIMKLPK 526
            .|..:.::|.....|::|:|.....::...|:.|.:....||.:|:..|:|:.|:.:        
Zfish   533 CDADLEELAANCSALQHLDILGTRMVSSASLRKLLQCCPRLKLLDVSFCSQIDSRFV-------- 589

  Fly   527 LQKLNLGLW 535
             |:|| ||:
Zfish   590 -QELN-GLF 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 13/34 (38%)
AMN1 <226..>334 CDD:187754 25/109 (23%)
leucine-rich repeat 236..256 CDD:275381 6/19 (32%)
leucine-rich repeat 263..288 CDD:275381 4/25 (16%)
leucine-rich repeat 289..314 CDD:275381 5/25 (20%)
leucine-rich repeat 315..347 CDD:275381 9/31 (29%)
AMN1 347..524 CDD:187754 50/184 (27%)
leucine-rich repeat 348..373 CDD:275381 5/24 (21%)
leucine-rich repeat 374..398 CDD:275381 10/28 (36%)
leucine-rich repeat 399..424 CDD:275381 10/24 (42%)
leucine-rich repeat 425..450 CDD:275381 7/26 (27%)
leucine-rich repeat 451..475 CDD:275381 6/24 (25%)
leucine-rich repeat 476..501 CDD:275381 5/24 (21%)
fbxl4NP_001007316.1 F-box-like 266..312 CDD:289689 20/67 (30%)
leucine-rich repeat 281..303 CDD:275381 12/39 (31%)
leucine-rich repeat 304..326 CDD:275381 7/31 (23%)
AMN1 <317..436 CDD:187754 33/152 (22%)
leucine-rich repeat 333..362 CDD:275381 8/32 (25%)
leucine-rich repeat 363..388 CDD:275381 7/45 (16%)
leucine-rich repeat 389..413 CDD:275381 9/31 (29%)
AMN1 414..591 CDD:187754 50/188 (27%)
leucine-rich repeat 414..438 CDD:275381 5/24 (21%)
leucine-rich repeat 439..466 CDD:275381 10/28 (36%)
leucine-rich repeat 467..492 CDD:275381 10/24 (42%)
leucine-rich repeat 493..520 CDD:275381 7/26 (27%)
leucine-rich repeat 521..545 CDD:275381 6/23 (26%)
leucine-rich repeat 547..572 CDD:275381 5/24 (21%)
leucine-rich repeat 573..598 CDD:275381 11/34 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.