powered by:
Protein Alignment Ppa and AgaP_AGAP011929
DIOPT Version :9
Sequence 1: | NP_001261138.1 |
Gene: | Ppa / 37602 |
FlyBaseID: | FBgn0020257 |
Length: | 562 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001238345.1 |
Gene: | AgaP_AGAP011929 / 4577562 |
VectorBaseID: | AGAP011929 |
Length: | 145 |
Species: | Anopheles gambiae |
Alignment Length: | 36 |
Identity: | 15/36 - (41%) |
Similarity: | 16/36 - (44%) |
Gaps: | 0/36 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 147 THISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDA 182
|...||..|:|..||..|...|...||..|..|.||
Mosquito 72 TGFDNLPMEILLNIFRFLNGVDRDAAALTCKRWFDA 107
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1947 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.