DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ppa and fbxl3b

DIOPT Version :9

Sequence 1:	NP_001261138.1	Gene:	Ppa / 37602	FlyBaseID:	FBgn0020257	Length:	562	Species:	Drosophila melanogaster
Sequence 2:	NP_001006075.1	Gene:	fbxl3b / 450055	ZFINID:	ZDB-GENE-041010-178	Length:	162	Species:	Danio rerio

Alignment Length:	115	Identity:	32/115 - (27%)
Similarity:	54/115 - (46%)	Gaps:	10/115 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   137 SPESPPPVEGTHISNLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKL----- 196
            |.:...||:.   ..|..|:|.||.::||:.|...|:|||..|..|.:...:|:..|.:|
Zfish    30 SEDGDGPVDW---GQLPQEILLQILQYLPLLDRAIASQVCHRWNQAFHMPELWRCFEFELNQPAS 91

  Fly   197 -HLKRSSPSLFNCLVKRGIKKVQILSLR-RSLKDLVLGVPALTSLNLSGC 244
             :|:.:.|.|...::||....:|.:|.: |:.....|..|..|.:.:..|
Zfish    92 SYLQATHPELIKQIIKRHANHLQYVSFKVRTHTHTQLTQPTFTPVCVCVC 141

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ppa	NP_001261138.1	F-box-like	149..190	CDD:289689	14/40 (35%)
		AMN1	<226..>334	CDD:187754	4/19 (21%)
		leucine-rich repeat	236..256	CDD:275381	2/9 (22%)
		leucine-rich repeat	263..288	CDD:275381
		leucine-rich repeat	289..314	CDD:275381
		leucine-rich repeat	315..347	CDD:275381
		AMN1	347..524	CDD:187754
		leucine-rich repeat	348..373	CDD:275381
		leucine-rich repeat	374..398	CDD:275381
		leucine-rich repeat	399..424	CDD:275381
		leucine-rich repeat	425..450	CDD:275381
		leucine-rich repeat	451..475	CDD:275381
		leucine-rich repeat	476..501	CDD:275381
fbxl3b	NP_001006075.1	F-box-like	39..80	CDD:289689	14/43 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910