DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Kdm2

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster


Alignment Length:439 Identity:104/439 - (23%)
Similarity:167/439 - (38%) Gaps:102/439 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 HHQTIAVLNNLNSHCGGSGSNGAATSGGAAIGGAGAGGAPSWAMDELYQQTELPGLTRTGATTTH 75
            |....|...:.....||:|:...:|:..:..||.|.....:....:|.||. |...||       
  Fly   931 HESNDAPCGSSAEGAGGAGNANVSTNQWSGSGGGGGSRKKNSIRSQLAQQM-LNSSTR------- 987

  Fly    76 HHLLRFTPYALHHRPPHHQLQTLPPALYLQHAAAAAAAAAAAAAHAQHHHHHHHHLPHRPASPES 140
              :|:...|.:.            ||.....::::....:|:|.:...:..:........|....
  Fly   988 --VLKKPQYVVR------------PASGTGSSSSSGNGGSASATNGISNGSNQSGANSCGAGNGE 1038

  Fly   141 PPPVEGT--------------HISN-----LFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAK 186
                .||              |.|:     |.|.:|:.||.:||...|.....||..|.:||...
  Fly  1039 ----RGTNNGGLSGSNGLGNQHYSSSQNLALDPTVLKIIFRYLPQDTLVTCCSVCKVWSNAAVDP 1099

  Fly   187 SVWKGVEAKLHLKRSSPSLFNCLVKRG-----IKKVQILSLRRSLKDLVLGVPALTSLNLSGCFN 246
            .:||.:....|  :.|.||...:|:|.     :...||  .:|.|..||..:|||.:|:|..|..
  Fly  1100 DLWKKMNCSEH--KMSASLLTAIVRRQPEHLILDWTQI--AKRQLAWLVARLPALKNLSLQNCPI 1160

  Fly   247 VADMNLGHAFSVDLPNLKTLDLSLCKQITDTSLGRIAQ--------------HLRNLETLELGGC 297
            .|.:.|....   .|.|:|||||..:.:.|.::..|..              .||:|:.::|.| 
  Fly  1161 QAVLALHTCL---CPPLQTLDLSFVRGLNDAAIRDILSPPKDSRPGLSDSKTRLRDLKVMKLAG- 1221

  Fly   298 CNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDE 362
            .:|::..:..|...|..|:||:|.||..|:|.|:..:...:..||.                   
  Fly  1222 TDISDVAVRYITQSLPYLRHLDLSSCQRITDAGVAQIGTSTTATAR------------------- 1267

  Fly   363 ALGHIAQGLTSLKSINLSFCVSVTDSGLKHLARMPKLEQLNLRSCDNIS 411
                       |..:|||.|..|:::.|:|||:...|..|:||....:|
  Fly  1268 -----------LTELNLSACRLVSENALEHLAKCEGLIWLDLRHVPQVS 1305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 14/45 (31%)
AMN1 <226..>334 CDD:187754 37/121 (31%)
leucine-rich repeat 236..256 CDD:275381 6/19 (32%)
leucine-rich repeat 263..288 CDD:275381 9/38 (24%)
leucine-rich repeat 289..314 CDD:275381 6/24 (25%)
leucine-rich repeat 315..347 CDD:275381 11/31 (35%)
AMN1 347..524 CDD:187754 15/65 (23%)
leucine-rich repeat 348..373 CDD:275381 0/24 (0%)
leucine-rich repeat 374..398 CDD:275381 10/23 (43%)
leucine-rich repeat 399..424 CDD:275381 5/13 (38%)
leucine-rich repeat 425..450 CDD:275381
leucine-rich repeat 451..475 CDD:275381
leucine-rich repeat 476..501 CDD:275381
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689 12/34 (35%)
leucine-rich repeat 1102..1125 CDD:275381 8/24 (33%)
leucine-rich repeat 1126..1149 CDD:275381 6/24 (25%)
leucine-rich repeat 1150..1173 CDD:275381 6/25 (24%)
AMN1 1166..>1320 CDD:187754 44/174 (25%)
leucine-rich repeat 1174..1213 CDD:275381 9/38 (24%)
leucine-rich repeat 1214..1238 CDD:275381 6/24 (25%)
leucine-rich repeat 1239..1267 CDD:275381 10/27 (37%)
leucine-rich repeat 1268..1292 CDD:275381 10/23 (43%)
leucine-rich repeat 1293..1317 CDD:275381 5/13 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.