DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Skp2

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster


Alignment Length:397 Identity:87/397 - (21%)
Similarity:159/397 - (40%) Gaps:104/397 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 PVEGTHISN-------LFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKR 200
            |....||::       |..|:|..||:.||.:.|.|.|.||..:...:..:::|..::  |.|:.
  Fly   226 PAMSAHINSGINYFERLSDEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETLWTRLD--LGLRT 288

  Fly   201 SSPSLFNCLVKRGIKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKT 265
            ..|.....:|:||:..:::  .:.|:::     ||.....                .|....|:.
  Fly   289 IRPGALEQIVRRGVLVIRL--AQTSIQE-----PAFAPYT----------------EVFRTRLQY 330

  Fly   266 LDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQG 330
            ||||:. .||.:||..:..|.|.                       |||:...|:    .:.|..
  Fly   331 LDLSMA-SITRSSLLTLLSHCRQ-----------------------LKKISLENI----ELDDDI 367

  Fly   331 IGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSG---LKH 392
            ...:|        .|..||.:.|.....|:..::..:.:.||||.|:|:|:.....|:.   :.|
  Fly   368 CAEIA--------KNEALEAVNLTMASGLTSNSVRLMMESLTSLSSLNISWTDLSADAVTALVTH 424

  Fly   393 LARMPKLEQLNLRSCDNI-SDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSL 456
            ::  |.|.:||:..|..: .|..:|.|.:....:..||:|.|:.::...:|.|.: ...|..||:
  Fly   425 IS--PNLIRLNIAGCRRVLFDSHVATLQKRCPQLLELDLSDCNSLTPTVITAIMK-FKMLEYLSV 486

  Fly   457 NQCQITDHGMLKIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSKGIDII 521
            ::|.:..      |....||::                    :.:|..:|::|  .||...::::
  Fly   487 SRCYLIP------ATKFIELKS--------------------MPSLTYLDIFG--MLSDTAMEVL 523

  Fly   522 MK-LPKL 527
            .| |||:
  Fly   524 EKQLPKM 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 13/47 (28%)
AMN1 <226..>334 CDD:187754 19/107 (18%)
leucine-rich repeat 236..256 CDD:275381 0/19 (0%)
leucine-rich repeat 263..288 CDD:275381 10/24 (42%)
leucine-rich repeat 289..314 CDD:275381 1/24 (4%)
leucine-rich repeat 315..347 CDD:275381 4/31 (13%)
AMN1 347..524 CDD:187754 40/181 (22%)
leucine-rich repeat 348..373 CDD:275381 5/24 (21%)
leucine-rich repeat 374..398 CDD:275381 6/26 (23%)
leucine-rich repeat 399..424 CDD:275381 7/25 (28%)
leucine-rich repeat 425..450 CDD:275381 6/24 (25%)
leucine-rich repeat 451..475 CDD:275381 5/23 (22%)
leucine-rich repeat 476..501 CDD:275381 1/24 (4%)
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 13/46 (28%)
leucine-rich repeat 302..327 CDD:275381 4/47 (9%)
AMN1 309..480 CDD:187754 49/230 (21%)
leucine-rich repeat 328..352 CDD:275381 10/24 (42%)
leucine-rich repeat 353..376 CDD:275381 7/34 (21%)
leucine-rich repeat 377..402 CDD:275381 5/24 (21%)
leucine-rich repeat 403..428 CDD:275381 6/26 (23%)
leucine-rich repeat 429..455 CDD:275381 7/25 (28%)
leucine-rich repeat 456..480 CDD:275381 6/24 (25%)
leucine-rich repeat 481..500 CDD:275381 5/24 (21%)
leucine-rich repeat 506..529 CDD:275381 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.