DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ppa and dmac2l

DIOPT Version :9

Sequence 1:	NP_001261138.1	Gene:	Ppa / 37602	FlyBaseID:	FBgn0020257	Length:	562	Species:	Drosophila melanogaster
Sequence 2:	NP_956512.1	Gene:	dmac2l / 393187	ZFINID:	ZDB-GENE-040426-959	Length:	199	Species:	Danio rerio

Alignment Length:	94	Identity:	30/94 - (31%)
Similarity:	42/94 - (44%)	Gaps:	13/94 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   322 SCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSD---EALGHIAQGLTSLKSINLSFCV 383
            ||  |..:|..||        ||...:|.:.|..|..:.|   |.||.|.....::|.:.:..|.
Zfish    94 SC--IMYRGFDHL--------EGLEHVEEIRLNKCIYIEDACLERLGQIKTLQDTVKQMTVVSCG 148

  Fly   384 SVTDSGLKHLARMPKLEQLNLRSCDNISD 412
            :|||.||..|..:.|||:|.|.....:.|
Zfish   149 NVTDKGLIALHHLGKLERLFLSDLPGVKD 177

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ppa	NP_001261138.1	F-box-like	149..190	CDD:289689
		AMN1	<226..>334	CDD:187754	4/11 (36%)
		leucine-rich repeat	236..256	CDD:275381
		leucine-rich repeat	263..288	CDD:275381
		leucine-rich repeat	289..314	CDD:275381
		leucine-rich repeat	315..347	CDD:275381	8/24 (33%)
		AMN1	347..524	CDD:187754	22/69 (32%)
		leucine-rich repeat	348..373	CDD:275381	8/27 (30%)
		leucine-rich repeat	374..398	CDD:275381	8/23 (35%)
		leucine-rich repeat	399..424	CDD:275381	5/14 (36%)
		leucine-rich repeat	425..450	CDD:275381
		leucine-rich repeat	451..475	CDD:275381
		leucine-rich repeat	476..501	CDD:275381
dmac2l	NP_956512.1	leucine-rich repeat	111..129	CDD:275381	5/17 (29%)
dmac2l	NP_956512.1	leucine-rich repeat	132..163	CDD:275381	9/30 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910