DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and CG4911

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001286990.1 Gene:CG4911 / 39043 FlyBaseID:FBgn0035959 Length:450 Species:Drosophila melanogaster


Alignment Length:437 Identity:80/437 - (18%)
Similarity:150/437 - (34%) Gaps:149/437 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 LEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHL---------KRSSPSLFNCLV-- 210
            |..||::|..:|...||.||.:||.|.:.|..::....:|.:         .||..:|...|:  
  Fly    18 LNHIFDYLNPQDRRSAAGVCFSWRHALFQKRYFRNFRFQLDVGCDDQLAFFHRSMANLAMELIVV 82

  Fly   211 -----------KRG-IKKV----QILSLRRSLKDLVLGVPALTSLN------LSGCF-------- 245
                       .|| :.||    .|..||....:  :|:.|:.:::      :..||        
  Fly    83 FDFQNAVHIQKMRGLLYKVAHCDNIQKLRFQTHN--VGLVAIGNMHSEHLLAIEQCFVEPLILFL 145

  Fly   246 -------NVADMN-------LGHAF-----------SVDLPNLK---------TLDLSLCK---- 272
                   .:.|:.       .||.|           .:.|.::|         :||.:|.:    
  Fly   146 SRKRQPCQLLDLGAIEALSYYGHDFLKAMGKPQELLQLTLASIKYDPSHYPILSLDSTLLQKCAA 210

  Fly   273 -QITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNL-RSCW-----HISD-- 328
             |:.......::..|  |.|:::     :....||:...||...:|.:: .:.|     |.|.  
  Fly   211 LQVLSLDYDTLSDEL--LHTIQV-----LPLRKLLIAVHGLDSEEHPDVSETAWSNFSDHFSSIE 268

  Fly   329 ------QGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALG----HIAQGLTSLKSINLSFCV 383
                  .....:|.........|:.:.::.|..|::::.|||.    |..:.|.|:..:      
  Fly   269 LVLTLVYAYEAIALLQHRVLRSNMPVTHVRLLFCEKMNAEALDWMSLHYRETLRSIHYV------ 327

  Fly   384 SVTDSGLKHLARMPKLEQLNLRS---------CDNISDIGM-AYLTEGGSGINSLDVSFCDKISD 438
               |:..|:..||....:::|..         |..:.:|.: .||.:                  
  Fly   328 ---DAPYKYSNRMNSSRRVSLLQDPFVMMAWRCKQLEEIVVHGYLMD------------------ 371

  Fly   439 QALTHIAQGLYRLRSLSLNQCQIT--DHGMLKIAKALHELENLNIGQ 483
               .|...|:.|||...|.:.:::  |.....:..|.:|..:..:||
  Fly   372 ---PHNLVGIARLRGRQLKRLEVSMIDWSGAPLLNAYNEEISTLLGQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 13/32 (41%)
AMN1 <226..>334 CDD:187754 25/174 (14%)
leucine-rich repeat 236..256 CDD:275381 5/47 (11%)
leucine-rich repeat 263..288 CDD:275381 6/38 (16%)
leucine-rich repeat 289..314 CDD:275381 6/24 (25%)
leucine-rich repeat 315..347 CDD:275381 6/45 (13%)
AMN1 347..524 CDD:187754 28/153 (18%)
leucine-rich repeat 348..373 CDD:275381 7/28 (25%)
leucine-rich repeat 374..398 CDD:275381 4/23 (17%)
leucine-rich repeat 399..424 CDD:275381 5/34 (15%)
leucine-rich repeat 425..450 CDD:275381 2/24 (8%)
leucine-rich repeat 451..475 CDD:275381 5/25 (20%)
leucine-rich repeat 476..501 CDD:275381 2/8 (25%)
CG4911NP_001286990.1 F-box 8..53 CDD:279040 13/34 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.