DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and CG11044

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster


Alignment Length:460 Identity:102/460 - (22%)
Similarity:158/460 - (34%) Gaps:137/460 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PEL-LEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKG--VEAKLHLKRSSPSLFN-------- 207
            |:| |||||.:|..::...|..||..|..|.|..:||..  |:.:...|..    ||        
  Fly    55 PDLVLEQIFTYLTPKERYYAGLVCRQWYRAFYLPTVWNNFLVDDRTLTKPK----FNYYSGWQFC 115

  Fly   208 --------CLVKRGIKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFS--VDLPN 262
                    ||.:.|              ..|.|:               :....|:|:  .....
  Fly   116 LDHMRTQFCLSRIG--------------RYVRGI---------------EFRPWHSFNNIFQFMT 151

  Fly   263 LKTLDLSLCKQIT-DTSLGRIAQHLRNLETLELGGCCNITN----TGLLLIAWG---LKKLKHLN 319
            :.|.::...:::. ||....|...:|   ||.....||::.    .|:.|...|   |:.||.|.
  Fly   152 MLTWNIDKGREVNPDTQFIGIGSRIR---TLVYHFPCNMSQPNDPEGIKLFGTGGQLLRVLKELL 213

  Fly   320 LRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVS 384
            ||    ::|.....|..|..|..|.|            .|.||.   :....|.::.:||   |:
  Fly   214 LR----LTDLHTLKLVDFVLERYEAN------------HLLDEV---VCSCCTKMRVLNL---VN 256

  Fly   385 VT--DSGLKHLARMPKLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQAL--THIA 445
            ||  ...:.|:.....|:.|.: |..||.|..::.|                  :|..|  .|:.
  Fly   257 VTTMHCPIMHVGLFLNLQVLTI-SPQNIDDDVLSLL------------------ADTKLRHLHLL 302

  Fly   446 QGLYRLRSLSLNQCQITDHGMLKIAK---ALH-ELENLNIGQ--------------CSRITDKGL 492
            |..|....|:::.|.:.....:|...   .:| .||||..|:              |:..|....
  Fly   303 QNCYTPSHLTISACGVKAWRNVKKTNPRLRVHLRLENLTDGEVVLQPEAPVHSITYCAPQTRIRA 367

  Fly   493 QTLAEDLTNLK-TIDLYG---CTQLSS-----KGIDIIMKLPKLQKLNLGLWLVRXCVHHDCNAC 548
            :.|...:.:.| |:.:||   ..:.||     ..||.:|.|...|..|:...::|..|.......
  Fly   368 ELLVRMVDHYKSTLAVYGHELLPRFSSPKPFHSRIDSLMLLMCRQCFNVDTLIIREKVSTSTLLL 432

  Fly   549 AAKEA 553
            .||.|
  Fly   433 IAKTA 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 15/36 (42%)
AMN1 <226..>334 CDD:187754 23/117 (20%)
leucine-rich repeat 236..256 CDD:275381 1/19 (5%)
leucine-rich repeat 263..288 CDD:275381 4/25 (16%)
leucine-rich repeat 289..314 CDD:275381 8/31 (26%)
leucine-rich repeat 315..347 CDD:275381 11/31 (35%)
AMN1 347..524 CDD:187754 43/207 (21%)
leucine-rich repeat 348..373 CDD:275381 3/24 (13%)
leucine-rich repeat 374..398 CDD:275381 6/25 (24%)
leucine-rich repeat 399..424 CDD:275381 7/24 (29%)
leucine-rich repeat 425..450 CDD:275381 4/26 (15%)
leucine-rich repeat 451..475 CDD:275381 4/27 (15%)
leucine-rich repeat 476..501 CDD:275381 8/38 (21%)
CG11044NP_611456.1 F-box-like 51..94 CDD:289689 16/38 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.