DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and Fbxl2

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:XP_038938600.1 Gene:Fbxl2 / 363156 RGDID:1562243 Length:439 Species:Rattus norvegicus


Alignment Length:394 Identity:121/394 - (30%)
Similarity:191/394 - (48%) Gaps:44/394 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 QIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSLFNC------LVKRGIKK- 216
            :||..|.:..|.|.||:..||...|...|.|:.|:           |||.      .|...|.| 
  Rat    38 RIFSFLDIVTLCRCAQISKAWNILALDGSNWQRVD-----------LFNFQTDVEGRVVENISKR 91

  Fly   217 ----VQILSLR-------RSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSL 270
                ::.||||       .|||........:..|||:||..:.|... ::.|.....||.|||:.
  Rat    92 CGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTC-YSLSRFCSKLKHLDLTS 155

  Fly   271 CKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHLA 335
            |..:|::||..|::..||||.|.|..|..||..|:..:..|.:.||.|.||.|..:.|:.:.|:.
  Rat   156 CVSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHIQ 220

  Fly   336 GFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCVSVTDSGLKHLA-RMPKL 399
            ....|       |..|.||.|.|::|:.:..|.:|...|:::.||.|.::||:.|..|. ..|:|
  Rat   221 NHCHE-------LVSLNLQSCSRITDDGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRL 278

  Fly   400 EQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQCQ-ITD 463
            :.|....|.:::|.|...|......:..:|:..|..|:|..|..::....:|::|||:.|: |||
  Rat   279 QVLEAARCSHLTDAGFTLLARNCHDLEKMDLEECVLITDSTLIQLSIHCPKLQALSLSHCELITD 343

  Fly   464 HGMLKIAKAL--HE-LENLNIGQCSRITDKGLQTLAEDLTNLKTIDLYGCTQLSSKGID-IIMKL 524
            .|:|.::.:.  || |..|.:..|..:||..|:.| |:...|:.::||.|.|::..||. :..:|
  Rat   344 EGILHLSSSTCGHERLRVLELDNCLLVTDASLEHL-ENCRGLERLELYDCQQVTRAGIKRMRAQL 407

  Fly   525 PKLQ 528
            |:::
  Rat   408 PRVK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 11/30 (37%)
AMN1 <226..>334 CDD:187754 37/107 (35%)
leucine-rich repeat 236..256 CDD:275381 6/19 (32%)
leucine-rich repeat 263..288 CDD:275381 10/24 (42%)
leucine-rich repeat 289..314 CDD:275381 9/24 (38%)
leucine-rich repeat 315..347 CDD:275381 9/31 (29%)
AMN1 347..524 CDD:187754 56/182 (31%)
leucine-rich repeat 348..373 CDD:275381 9/24 (38%)
leucine-rich repeat 374..398 CDD:275381 8/24 (33%)
leucine-rich repeat 399..424 CDD:275381 6/24 (25%)
leucine-rich repeat 425..450 CDD:275381 5/24 (21%)
leucine-rich repeat 451..475 CDD:275381 10/26 (38%)
leucine-rich repeat 476..501 CDD:275381 8/24 (33%)
Fbxl2XP_038938600.1 F-box-like <38..72 CDD:403981 12/33 (36%)
leucine-rich repeat 68..95 CDD:275381 8/37 (22%)
AMN1 <92..239 CDD:187754 50/154 (32%)
leucine-rich repeat 96..115 CDD:275381 7/18 (39%)
leucine-rich repeat 122..147 CDD:275381 7/25 (28%)
leucine-rich repeat 148..173 CDD:275381 10/24 (42%)
leucine-rich repeat 174..199 CDD:275381 9/24 (38%)
AMN1 184..383 CDD:187754 62/206 (30%)
leucine-rich repeat 200..225 CDD:275381 8/24 (33%)
leucine-rich repeat 226..251 CDD:275381 9/24 (38%)
leucine-rich repeat 252..277 CDD:275381 8/24 (33%)
leucine-rich repeat 278..303 CDD:275381 6/24 (25%)
leucine-rich repeat 304..329 CDD:275381 5/24 (21%)
leucine-rich repeat 330..352 CDD:275381 10/21 (48%)
leucine-rich repeat 359..378 CDD:275381 6/18 (33%)
leucine-rich repeat 384..409 CDD:275381 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.